Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020317 (Theg)
Chromosomal location
Chr 10: 79039223 - 79049850 (-)
Description
testicular haploid expressed gene Gene [Source:MGI Symbol;Acc:MGI:1338756]
RefSeq_dna
NM_199226 NM_011583 
RefSeq_peptide
NP_954696.1 NP_035713.1 
UniGene
Mm.89197 
MGI
MGI:1338756 
Uniprot/SWISSPROT
Q9JMB1 
Human Ortholog
ENSG00000105549 (THEG)
Omim not available
UniTrap UNI31261
Vector Insertion
Chr 10: 79042683 - 79046601
Public Clones IST13441F12 (tigm) IST10058F4 (tigm) IST14646H3 (tigm) IST11329B5 (tigm)
IST12279C7 (tigm) IST11594A3 (tigm) IST12407C4 (tigm) IST10047C3 (tigm)
IST14711H11 (tigm) IST14019A12 (tigm) IST12977F12 (tigm) IST14946G1 (tigm)
IST12828G12 (tigm) IST14114B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000077433
Sequence
GGAGGGAGTGAGGTTAAAGGGTTAGGAGGGGCAGTACACATGGGGGAACTTGGTGAACACCGGGCCAGTTTGCTCAGTAACCCAATCCCGGAGGTCAAGA

CTTTGGGAGAGTTAAAGCAGGGACAGAACAATGGCAATTTGGACCTTGAGAGCGAGCCATTTGGGAGCCATTGGTTGCAGGGCTCTAAGGCCACTACAGG

GCGAACCTCAGAAGAACCAGAGGAGGAAATCCCCCCAGAGGAGATGGCTGGGGAAGAGCTCCCGGAGACCTCCAATCTGGATGGTCCTCTTCAACAAGAC

CTGGAGGTGGAAGTGGTTGAAATGAG CCATCTGTCCATCACTGAGCGGACTCCCAGTGTCTCCACAGCCAAGGGCAGGAAAAAGAGGAGCCGGAGGCTG

CTGGAGCTGGCGAAGCCTAAGACCAACTGGCAATGTCTGAGAGACAG GCCTTCTGTATACTGGACCGAGCGATTTATCGAGGACACCACGTTGACCATC

ACGGTCCCTG TGGTGTCCCAGCGCATGGAGGAGCTTTCGAGGCCCAAGCGGTTCTACCAGGAATATTACAACAATAACAG - UNI31263 - GACAA

CGCCCATCTGGTCCATCCCTCGGTCCACTCTGGAGTACCAAGCTTCTAACCGGCTGAAGCAACTGGCTACCCCGAAGGTTCGCAATAACATCTGGAGCAT

TAACATGTCTGAG - UNI31263 - GTTTCCCAAGTCTCCAGAGCAGCCCAGATGGCAGTCCCGACCCCACGGACGCTTCGGCTGGCAAAGCCCAGGC

CCCCAGCCACTCTGTTGGAAGAGTGGGACCCTATGCCAAAACCCAAGCCTTACGTGTCAGACTATAACCGCCTTCTTCAGCTGGCAA - UNI31263 -

 CACCCAAGGCCCTGTCAGAAAAGTGCGTTCCTGATCGCAGTCCTCAGTGGGAGGTCCTGGATGTCACCAAGAACGCGGTGGCCAGTTCACGGATCATCT

CCCTGGCCCAGCCCAAAATTCGAAAGGACCTCAACGAGGGCTACAACCCATACTACATCTCCCCAGCCTCTCTGGTGGCTCAGGCATCTCCTCGAATTTA

TGAGCTTGCCACCCCCAAATACATCACCAAGAAAGTGTGACAACCAAGCCTTCTCTCCAGCTCACCCCCAGTAAACACCAAGTGCATCCT
Translation
MGELGEHRASLLSNPIPEVKTLGELKQGQNNGNLDLESEPFGSHWLQGSKATTGRTSEEPEEEIPPEEMAGEELPETSNLDGPLQQDLEVEVVEMS SHL

SITERTPSVSTAKGRKKRSRRLLELAKPKTNWQCLRDR RPSVYWTERFIEDTTLTITVPV VVSQRMEELSRPKRFYQEYYNNNR - UNI31263 - 

RTTPIWSIPRSTLEYQASNRLKQLATPKVRNNIWSINMSE - UNI31263 - VSQVSRAAQMAVPTPRTLRLAKPRPPATLLEEWDPMPKPKPYVSDY

NRLLQLAT - UNI31263 - TPKALSEKCVPDRSPQWEVLDVTKNAVASSRIISLAQPKIRKDLNEGYNPYYISPASLVAQASPRIYELATPKYITKK

V
Transcript ENSMUST00000020566
Sequence
GGAGGGAGTGAGGTTAAAGGGTTAGGAGGGGCAGTACACATGGGGGAACTTGGTGAACACCGGGCCAGTTTGCTCAGTAACCCAATCCCGGAGGTCAAGA

CTTTGGGAGAGTTAAAGCAGGGACAGAACAATGGCAATTTGGACCTTGAGAGCGAGCCATTTGGGAGCCATTGGTTGCAGGGCTCTAAGGCCACTACAGG

GCGAACCTCAGAAGAACCAGAGGAGGAAATCCCCCCAGAGGAGATGGCTGGGGAAGAGCTCCCGGAGACCTCCAATCTGGATGGTCCTCTTCAACAAGAC

CTGGAGGTGGAAGTGGTTGAAATGAG CCATCTGTCCATCACTGAGCGGACTCCCAGTGTCTCCACAGCCAAGGGCAGGAAAAAGAGGAGCCGGAGGCTG

CTGGAGCTGGCGAAGCCTAAGACCAACTGGCAATGTCTGAGAGACAG GACGGGGCGCTGTTGTAAGGGCTATGCCTGGATTTCCCCACGCAAGACCAAC

TTGCAGTTCTGCCTGTATTG GCCTTCTGTATACTGGACCGAGCGATTTATCGAGGACACCACGTTGACCATCACGGTCCCTG TGGTGTCCCAGCGCAT

GGAGGAGCTTTCGAGGCCCAAGCGGTTCTACCAGGAATATTACAACAATAACAG - UNI31263 - GACAACGCCCATCTGGTCCATCCCTCGGTCCA

CTCTGGAGTACCAAGCTTCTAACCGGCTGAAGCAACTGGCTACCCCGAAGGTTCGCAATAACATCTGGAGCATTAACATGTCTGAG - UNI31263 - 

GTTTCCCAAGTCTCCAGAGCAGCCCAGATGGCAGTCCCGACCCCACGGACGCTTCGGCTGGCAAAGCCCAGGCCCCCAGCCACTCTGTTGGAAGAGTGGG

ACCCTATGCCAAAACCCAAGCCTTACGTGTCAGACTATAACCGCCTTCTTCAGCTGGCAA - UNI31263 - CACCCAAGGCCCTGTCAGAAAAGTGC

GTTCCTGATCGCAGTCCTCAGTGGGAGGTCCTGGATGTCACCAAGAACGCGGTGGCCAGTTCACGGATCATCTCCCTGGCCCAGCCCAAAATTCGAAAGG

ACCTCAACGAGGGCTACAACCCATACTACATCTCCCCAGCCTCTCTGGTGGCTCAGGCATCTCCTCGAATTTATGAGCTTGCCACCCCCAAATACATCAC

CAAGAAAGTGTGACAACCAAGCCTTCTCTCCAGCTCACCCCCAGTAAACACCAAGTGCATCCT
Translation
MGELGEHRASLLSNPIPEVKTLGELKQGQNNGNLDLESEPFGSHWLQGSKATTGRTSEEPEEEIPPEEMAGEELPETSNLDGPLQQDLEVEVVEMS SHL

SITERTPSVSTAKGRKKRSRRLLELAKPKTNWQCLRDR RTGRCCKGYAWISPRKTNLQFCLYW WPSVYWTERFIEDTTLTITVPV VVSQRMEELSRP

KRFYQEYYNNNR - UNI31263 - RTTPIWSIPRSTLEYQASNRLKQLATPKVRNNIWSINMSE - UNI31263 - VSQVSRAAQMAVPTPRTLRL

AKPRPPATLLEEWDPMPKPKPYVSDYNRLLQLAT - UNI31263 - TPKALSEKCVPDRSPQWEVLDVTKNAVASSRIISLAQPKIRKDLNEGYNPYY

ISPASLVAQASPRIYELATPKYITKKV

For any suggestions or comments, please send an email to unitrap@crg.es