Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020340 (Cyfip2)
Chromosomal location
Chr 11: 46007360 - 46125852 (-)
Description
cytoplasmic FMR1 interacting protein 2 Gene [Source:MGI (curated);Acc:Cyfip2-001]
RefSeq_dna
NM_133769 
RefSeq_peptide
NP_598530.2 
UniGene
Mm.392482 Mm.407410 Mm.154358 
MGI
MGI:1924134 
Uniprot/SWISSPROT
Q5SQX6 
Uniprot/SPTREMBL
Q5SQX7 Q5STT5 Q810V4 Q8K118 Q6PGK0 
Human Ortholog
ENSG00000055163 (CYFIP2)
Omim not available
UniTrap UNI36974
Vector Insertion
Chr 11: 46021789 - 46034969
Public Clones CMHD-GT_516C4-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3119
Vector Insertion
Chr 11: 46009970 - 46012492
Public Clones CD0259 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093165
Sequence
GGGGCCGCGGGCGGGGCGCGGCGGTCCGCCGGCGCAGCGGCGGAGCGGGGCTAAGCATCCTGCGCCCCGGCGCGGGGCCCTGCGGTAGCCTCGGGTCCCT

CCCCTGGACCTGCCACCGAGCCAG TGTGAAAGACAGGCGCCGCAGCCATGACCACCCACGTCACTTTGGAAGATGCCCTGTCCAACGTGGACCTGCTGG

AGGAACTGCCCCTCCCAGACCAGCAGCCATGTATCGAGCCCCCGCCATCCTCCATCATGTACCAG GCTAACTTTGACACGAACTTCGAGGACAGGAATG

CATTTGTCACGGGCATTGCAAGGTACATTGAGCAGGCAACGGTCCACTCCAGCATG AATGAAATGCTGGAGGAGGGCCACGACTATGCAGTCATGCTGT

ACACCTGGCGCAGCTGCTCCCGGGCCATCCCGCAG GTGAAGTGCAATGAGCAGCCCAATCGGGTCGAGATCTACGAGAAGACGGTGGAGGTGCTGGAGC

CAGAGGTCACCAAGCTCATGAAGTTCATGTACTTTCAG CGCAAGGCCATCGAGCGCTTCTGTAGCGAGGTGAAGCGGCTGTGTCACGCTGAGCGCAGGA

AGGACTTTGTCTCTGAGGCCTACCTGCTGACGCTGGGCAAGTTCATCAACATGTTCGCGGTCTTGGACGAGCTAAAGAACATGAAGTGCAGTGTCAAGAA

TGACCACTCTGCCTACAAGAG AGCAGCACAGTTCCTAAGGAAGATGGCGGACCCCCAGTCCATCCAGGAATCTCAGAACCTGTCCATGTTCCTGGCCAA

TCACAACAGGATCACCCAG TGTCTTCACCAGCAACTGGAAGTGATCCCGGGCTATGAGGAGCTGCTGGCAGACATTGTCAACATCTGTGTTGATTACTA

TGAGAATAAGATGTACCTGACGCCCAGTGAAAAGCACATGTTGCTCAAG GTGATGGGCTTTGGTCTCTATCTGATGGACGGAAATGTCAGTAACATTTA

CAAACTGGATGCCAAGAAGAGAATCAACCTTAGCAAAATTGATAAGTTTTTTAAG CAGCTGCAGGTGGTACCCCTTTTCGGCGACATGCAGATAGAGCT

GGCCAGATACATTAAGACCAGTGCTCACTATGAAGAGAACAAGTCCAA GTGGACATGCACTCAGAGCAGCATCAGCCCCCAGTACAACATCTGTGAGCA

GATGGTTCAGATCCGGGATGATCACATCCGCTTCATCTCTGAGCTGGCTCGCTACAGCAACAGCGAG GTGGTGACAGGCTCAGGGCTGGACAGCCAGAA

GTCGGATGAAGAGTACCGGGAGCTTTTTGACCTGGCCCTGCGAGGCCTGCAGCTTCTATCCAAGTGGAGTGCCCATGTCATGGAGGTG TACTCTTGGAA

GCTGGTTCACCCCACAGACAAGTTCTGCAACAAGGACTGCCCGGGCACCGCGGAAGAGTACGAGAGAGCCACGCGCTACAATTATACCAGCGAGGAGAAG

TTTGCCTTTGTGGAG GTGATTGCCATGATCAAGGGTTTGCAGGTGCTCATGGGAAGGATGGAGAGTGTCTTCAACCAGGCCATCCGCAACACTATCTAC

GCAGCCCTGCAGGATTTCGCCCAGGTGACGCTGCGGGAGCCGTTGCGGCAAGCAGTTCGAAAGAAAAAGAATGTCCTTATCAG CGTTCTGCAAGCAATT

CGAAAGACCATCTGTGACTGGGAGGGAGGCCGAGAGCCCCCCAATGACCCATGCTTAAGAGGGGAGAAGGACCCCAAAGGTGGCTTTGACATCAAGGTGC

CCCGCCGTGCTGTGGGTCCATCCAGCACACAG GCCTGCCAGTGGTCCCCGAGGGCTTTGTTTCACCCCACTGGTGGCACACAGGGCCGAAGAGGCTGCC

GATCCCTG CTGTACATGGTGCGCACCATGCTTGAGTCACTCATCGCAGACAAGAGCGGCTCCAAGAAGACGCTCAGAAGCAGCCTGGATGGCCCTATCG

TCCTTGCCATAGAGGACTTCCACAAGCAGTCCTTCTTTTTCACACACCTGCTTAACATCAGCG AGGCTCTTCAGCAGTGCTGTGACCTCTCCCAGCTCT

GGTTCCGAGAATTCTTCCTGGAGTTGACCATGGGCCGGCGAATCCAGTTCCCGATTGAGATGTCCATGCCCTGGATTCTAACGGACCATATTCTGGAAAC

CAAAGAACCTTCCATGATGGA GTATGTCCTCTACCCCTTGGATCTGTACAACGACAGCGCCTACTATGCCCTCACCAAATTCAAAAAGCAGTTCCTGTA

TGACGAGATCGAAGCCGAG GTAAACCTGTGTTTTGATCAGTTTGTCTACAAGCTGGCTGACCAGATCTTCGCCTACTACAAAGCCATGGCCGGCAG TG

TCCTGCTGGATAAACGTTTTAGAGCTGAGTGTAAGAACTATGGGGTGATCATACCGTACCCGCCATCCAACCGCTACGAGACACTGCTGAAGCAGAGACA

TGTCCAG CTGTTGGGGAGATCAATTGACTTGAACAGACTCATCACCCAGCGGATCTCTGCTGCCATGTACAAGTCCTTGGACCAGGCCATCAGCCGCTT

TGAGAGTGAAGACCTGACCTCCATTGTG GAGCTGGAGTGGCTGCTGGAGATTAACCGACTCACACACCGACTCCTCTGTAAGCACATGACGCTAGACAG

CTTCGATGCCATGTTCCGAGAAGCCAATCATAACGTGTCTGCCCCTTACGGCCGCATCACCCTGCATGTCTTCTGGGAGCTGAACTTTGACTTTCTCCCC

AACTACTGCTATAATGGATCCACAAACCG TTTTGTCCGAACTGCCATCCCTTTCACCCAAGAACCACAACGGGATAAGCCCGCCAATGTCCAGCCTTAT

TACCTCTATGGATCCAAG CCTCTCAACATTGCCTACAGCCACATCTATAGCTCCTACCGGAACTTTGTGGGGCCCCCTCACTTCAAGACCATCTGCAGA

CTGTTGGGCTACCAGGGCATCGCTGTGGTCATGGAGGAACTGCTGAAAATCGTCAAGAGCTTG CTCCAAGGCACCATCCTGCAGTACGTGAAGACGCTC

ATAGAGGTGATGCCGAAAATCTGTCGTTTGCCTCGGCACGAGTACGGCTCTCCAG GAATCCTGGAGTTCTTCCACCACCAACTGAAGGACATCATCGAG

TATGCAGAACTCAAAACAGACGTGTTCCAGAGCCTCCGAGAGGTGGGCAACGCCATCCTGTTCTGCCTCCTCATAGAGCAAGCTCTG TCTCAGGAGGAA

GTCTGTGATTTGCTCCATGCTGCACCCTTCCAAAACATTCTGCCCCGAGTCTACATCAAAG AGGGGGAGCGCCTGGAAGTCCGGATGAAGCGCCTCGAG

GCCAAGTACGCCCCACTTCACCTGGTTCCCCTGATAGAGCGGCTGGGGACGCCTCAG CAAATCGCCATCGCTCGGGAGGGTGACCTGCTGACCAAGGAG

CGGCTCTGCTGCGGCCTGTCCATGTTTGAGGTCATCCTGACCCGAATCCGGAGCTACCTGCAGGACCCCATCTGGAGGGGCCCGCCACCCACCAATGGCG

TCATGCATGTGGATGAGTGTGTGGAGTTTCACCGGCTGTGGAGTGCCATGCAGTTTGTCTACTGTATCCCTGTGGGGACCAACGAGTTCACAGCTGA GC

AGTGCTTCGGTGACGGCTTGAACTGGGCCGGCTGCTCCATCATTGTCTTGCTGGGCCAGCAGCGGCGCTTTGACCTGTTTGACTTCTGTTATCATCTGCT

GAAGGTGCAGAGGCAGGACGGGAAGGATGAGATCATTAAGAATGTG - UNI3119 - CCTCTGAAGAAGATGGCTGACCGCATCAGGAAGTACCAGAT

CTTGAACAATGAGGTTTTTGCCATCCTGAACAAGTACATGAAGTCTGTAGAGACAGACAGTTCCACCGTAGAGCATGTGCGCTGCTTCCAGCCCCCAATC

CACCAGTCATTGGCCACCACCTGCTAGGTAGAAAACCGTGCAGACCTTCAACCTGGAGGAGGAGGAGGAGGAGGAGAGAACACAGTGACCAGCCTGCAGC

AGGTCCAGTTGACAGTGTGTGGACAGGTCTGGAAGGAAAAGAAAACCTCCCCAACACATCTCTACCACTCCCAAGGGCTGGGCTCCCGCATGTTCCTCCC

ATGATATCTCCATGGTGGATTTTCCATAGTGTAAATGAAAAAAAAAACAACAAAAACACAGGGCAGTGTGTGCTTTCTTTTCTTTTTTTCCACCTTATCT

GTATTGAAGAGCTACTGTTTCCACCCTGCAGCTGCCCACTCCATCTGCGATTACTTCCCAAGACCGCCTCCCCAAGTCGTAACCTCCTACCCGCTATCTG

TATTTGATCCAGCACTATAGTCTTAGAGACATAGAAGAGAAGAGTGTAGCCATAGCAGAGATATCAGCCTGGCCCATTGGATATCTCAGCTTACTGGCCC

ATCTTCTGTGGCTTCTCCCTCCAGTTCCCTCACCACAGCACTTCCTGCTCGTGACATTAGGGATTCCACCACCAAAATCTGATCCCTGGTGAACCAGGAA

GAGGTTGCTGTTGTCAAGACAACAGATGATGCTGACCAAGATCTTTTACAGCCTCCCTAAGACCCACCCTAGACCTTCCTTACAGAACAGACCTAGAGAG

AAGAAAGTAAGGCTTGCAAAACCACACCACACTGGGTGGAACTAGGTGAAGATGACCAGGCCTACTGTGAGGGAGAGAGAGAGTCATCAGCACAGGGCAA

AACTCCAGATCCAAAGGATAAATGTTAGGCCTTGTTAACAGCGTGGGAAGATGAGGCACTCCTGGTCCTCAAACAGAGGCTTAGCACTGAGCCACATGGG

AATCCACATGGTCCGTCATAGCGCTACACATAGCATTCGTGAGTGACCAAGTCAGTGGCTGCTTAACACAGAACCTAATCCAGGAAAATCCCCCAAGAAA

GAAAACCTAAAGGGGTTACCTTAATTGGAGACAGGGTGGCAAGGAGGAAAAATATTTTTGTCAACAAGCTTCCTATCCCCAGACCCCTCCCCTCAAAAGG

AAGTCTTCTTTGAGCTAACTGGAATGTTCTCATGTCGGCTACTAAAAGATTCTTGGAATGTTCTTTTGCTCTCAATGTCCTGGTCTCTCCCTTTTGCTCA

AGCTCAGTCATGGGGATGTATTAACTTCTATGTTTCAGACTAAAACACCCCTGCACAGTCCCCACAAATAGCACATCTTTTAAAGAGATTGCCCAAGTCT

CCATATAGAGCTAGTCATCTGACCTGCAGAGAGGACATAGCCCTGAGCTCCCAAGACACAGGAATAATAGATATTCCTCTACCAGCCTGGGGAGGACAGA

AGACAGGAGTAACCATCCCCTGCCCCAGGAAGGTGATTGTTATCCATCACCGTTTTTTTAACCACACAGAGAAGAGAAGAGATGTGCATAATCTGTACTT

TGCCAGACAGGGCCATGTACCCCAGGGTGGTCATATAAATTAGAATCCTTAAGGATGGCACACCAGAGTGTTCCTTTCTGGACACTAACTTTGAATCTCT

GGGAATAGAGCCAGAAGACCTGCCTCTTCTCAGATATATCACTGCACACCACATACTCAGACCTTGCTGTAGATTGGACAACTCTACTAACTCTGGGTCT

CTCTGAGCAAGAGTAGGAGCATTTGTAGTGTAGGGTTGTGGTTTGAAACAGAAACTGTCCAGTCCTCCTGTCTGGCACTGTTAATTCTTAGTCTGATTAT

TTTTCAATGACCATAGCTGTATCCCAGAGGCAGATTCCACTTTCCAGATCGTCAGCTCTGGCTGGGGATAGAATGTGATAAACAGACTTTCCCCGCTTAG

TGTCCCCTCACTGCTCTGTAGAGATTTGGGCTGTTCATAAGGCCGCCTTCCTGGCAGCTCATCCCTTCTACCCTGCACTCCTGACCCCAACAGTTGACCC

TCTGGGAAGAGTCACATTCTGCTCAAGATATTTGATCCCAATAAATTGAGGTCCTCGCTTTGAGGACAGAGATTCCATTTTTGCAGCACTTGCCTGCAAA

CTCTGGACAACTTCAATGCTCTTTCCTCTCTAGTGGTCCTTGCCCCCCACCCCTTTGATTTTTTTTTTAATGTATTTAAAGATCAAGAAAAAAGCTTAGA

TTTTAAAATGTTTTAAAAAGAATTCTGTTTCAGAAATTGTCAAATGTGTACCATATTTGTATTAAGAGTTGTTGGGGATTTTTTGTACAATGAATTTACA

TTTATTTATGGTGAACTTATATTTACGCTTGTGATCAAATAATGATGTTAAATTCTTAAATCCTATTTGCTATGCAGCTGAAGATGATATTTTGATTTGT

ATTTTGGGGGTACCTGTGTTGAGTCGATAAAACATTTTCATCTCCATTAAAACTGCTTCCAAACCAGTT
Translation
         MQIELARYIKTSAHYEENKSK KWTCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSE VVTGSGLDSQKSDEEYRELFDLALRGLQ

LLSKWSAHVMEV YSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVE VIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLR

QAVRKKKNVLIS SVLQAIRKTICDWEGGREPPNDPCLRGEKDPKGGFDIKVPRRAVGPSSTQ ACQWSPRALFHPTGGTQGRRGCRSL LYMVRTMLES

LIADKSGSKKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISE EALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMME EYV

LYPLDLYNDSAYYALTKFKKQFLYDEIEAE VNLCFDQFVYKLADQIFAYYKAMAGS SVLLDKRFRAECKNYGVIIPYPPSNRYETLLKQRHVQ LLGR

SIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIV ELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNG

STNR RFVRTAIPFTQEPQRDKPANVQPYYLYGSK PLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSL LQGTILQYVKTLIEV

MPKICRLPRHEYGSPG GILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQAL SQEEVCDLLHAAPFQNILPRVYIKE EGERLEVRMKRL

EAKYAPLHLVPLIERLGTPQ QIAIAREGDLLTKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTA

E EQCFGDGLNWAGCSIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNV - UNI3119 - PLKKMADRIRKYQILNNEVFAILNKYMKSVETDSS

TVEHVRCFQPPIHQSLATTC
Transcript ENSMUST00000093166
Sequence
GGGGCCGCGGGCGGGGCGCGGCGGTCCGCCGGCGCAGCGGCGGAGCGGGGCTAAGCATCCTGCGCCCCGGCGCGGGGCCCTGCGGTAGCCTCGGGTCCCT

CCCCTGGACCTGCCACCGAGCCAG TGTGAAAGACAGGCGCCGCAGCCATGACCACCCACGTCACTTTGGAAGATGCCCTGTCCAACGTGGACCTGCTGG

AGGAACTGCCCCTCCCAGACCAGCAGCCATGTATCGAGCCCCCGCCATCCTCCATCATGTACCAG GCTAACTTTGACACGAACTTCGAGGACAGGAATG

CATTTGTCACGGGCATTGCAAGGTACATTGAGCAGGCAACGGTCCACTCCAGCATG AATGAAATGCTGGAGGAGGGCCACGACTATGCAGTCATGCTGT

ACACCTGGCGCAGCTGCTCCCGGGCCATCCCGCAG GTGAAGTGCAATGAGCAGCCCAATCGGGTCGAGATCTACGAGAAGACGGTGGAGGTGCTGGAGC

CAGAGGTCACCAAGCTCATGAAGTTCATGTACTTTCAG CGCAAGGCCATCGAGCGCTTCTGTAGCGAGGTGAAGCGGCTGTGTCACGCTGAGCGCAGGA

AGGACTTTGTCTCTGAGGCCTACCTGCTGACGCTGGGCAAGTTCATCAACATGTTCGCGGTCTTGGACGAGCTAAAGAACATGAAGTGCAGTGTCAAGAA

TGACCACTCTGCCTACAAGAG AGCAGCACAGTTCCTAAGGAAGATGGCGGACCCCCAGTCCATCCAGGAATCTCAGAACCTGTCCATGTTCCTGGCCAA

TCACAACAGGATCACCCAG TGTCTTCACCAGCAACTGGAAGTGATCCCGGGCTATGAGGAGCTGCTGGCAGACATTGTCAACATCTGTGTTGATTACTA

TGAGAATAAGATGTACCTGACGCCCAGTGAAAAGCACATGTTGCTCAAG GTGATGGGCTTTGGTCTCTATCTGATGGACGGAAATGTCAGTAACATTTA

CAAACTGGATGCCAAGAAGAGAATCAACCTTAGCAAAATTGATAAGTTTTTTAAG CAGCTGCAGGTGGTACCCCTTTTCGGCGACATGCAGATAGAGCT

GGCCAGATACATTAAGACCAGTGCTCACTATGAAGAGAACAAGTCCAA GTGGACATGCACTCAGAGCAGCATCAGCCCCCAGTACAACATCTGTGAGCA

GATGGTTCAGATCCGGGATGATCACATCCGCTTCATCTCTGAGCTGGCTCGCTACAGCAACAGCGAG GTGGTGACAGGCTCAGGGCTGGACAGCCAGAA

GTCGGATGAAGAGTACCGGGAGCTTTTTGACCTGGCCCTGCGAGGCCTGCAGCTTCTATCCAAGTGGAGTGCCCATGTCATGGAGGTG TACTCTTGGAA

GCTGGTTCACCCCACAGACAAGTTCTGCAACAAGGACTGCCCGGGCACCGCGGAAGAGTACGAGAGAGCCACGCGCTACAATTATACCAGCGAGGAGAAG

TTTGCCTTTGTGGAG GTGATTGCCATGATCAAGGGTTTGCAGGTGCTCATGGGAAGGATGGAGAGTGTCTTCAACCAGGCCATCCGCAACACTATCTAC

GCAGCCCTGCAGGATTTCGCCCAGGTGACGCTGCGGGAGCCGTTGCGGCAAGCAGTTCGAAAGAAAAAGAATGTCCTTATCAG CGTTCTGCAAGCAATT

CGAAAGACCATCTGTGACTGGGAGGGAGGCCGAGAGCCCCCCAATGACCCATGCTTAAGAGGGGAGAAGGACCCCAAAGGTGGCTTTGACATCAAGGTGC

CCCGCCGTGCTGTGGGTCCATCCAGCACACAG CTGTACATGGTGCGCACCATGCTTGAGTCACTCATCGCAGACAAGAGCGGCTCCAAGAAGACGCTCA

GAAGCAGCCTGGATGGCCCTATCGTCCTTGCCATAGAGGACTTCCACAAGCAGTCCTTCTTTTTCACACACCTGCTTAACATCAGCG AGGCTCTTCAGC

AGTGCTGTGACCTCTCCCAGCTCTGGTTCCGAGAATTCTTCCTGGAGTTGACCATGGGCCGGCGAATCCAGTTCCCGATTGAGATGTCCATGCCCTGGAT

TCTAACGGACCATATTCTGGAAACCAAAGAACCTTCCATGATGGA GTATGTCCTCTACCCCTTGGATCTGTACAACGACAGCGCCTACTATGCCCTCAC

CAAATTCAAAAAGCAGTTCCTGTATGACGAGATCGAAGCCGAG GTAAACCTGTGTTTTGATCAGTTTGTCTACAAGCTGGCTGACCAGATCTTCGCCTA

CTACAAAGCCATGGCCGGCAG TGTCCTGCTGGATAAACGTTTTAGAGCTGAGTGTAAGAACTATGGGGTGATCATACCGTACCCGCCATCCAACCGCTA

CGAGACACTGCTGAAGCAGAGACATGTCCAG CTGTTGGGGAGATCAATTGACTTGAACAGACTCATCACCCAGCGGATCTCTGCTGCCATGTACAAGTC

CTTGGACCAGGCCATCAGCCGCTTTGAGAGTGAAGACCTGACCTCCATTGTG GAGCTGGAGTGGCTGCTGGAGATTAACCGACTCACACACCGACTCCT

CTGTAAGCACATGACGCTAGACAGCTTCGATGCCATGTTCCGAGAAGCCAATCATAACGTGTCTGCCCCTTACGGCCGCATCACCCTGCATGTCTTCTGG

GAGCTGAACTTTGACTTTCTCCCCAACTACTGCTATAATGGATCCACAAACCG TTTTGTCCGAACTGCCATCCCTTTCACCCAAGAACCACAACGGGAT

AAGCCCGCCAATGTCCAGCCTTATTACCTCTATGGATCCAAG CCTCTCAACATTGCCTACAGCCACATCTATAGCTCCTACCGGAACTTTGTGGGGCCC

CCTCACTTCAAGACCATCTGCAGACTGTTGGGCTACCAGGGCATCGCTGTGGTCATGGAGGAACTGCTGAAAATCGTCAAGAGCTTG CTCCAAGGCACC

ATCCTGCAGTACGTGAAGACGCTCATAGAGGTGATGCCGAAAATCTGTCGTTTGCCTCGGCACGAGTACGGCTCTCCAG GAATCCTGGAGTTCTTCCAC

CACCAACTGAAGGACATCATCGAGTATGCAGAACTCAAAACAGACGTGTTCCAGAGCCTCCGAGAGGTGGGCAACGCCATCCTGTTCTGCCTCCTCATAG

AGCAAGCTCTG TCTCAGGAGGAAGTCTGTGATTTGCTCCATGCTGCACCCTTCCAAAACATTCTGCCCCGAGTCTACATCAAAG AGGGGGAGCGCCTG

GAAGTCCGGATGAAGCGCCTCGAGGCCAAGTACGCCCCACTTCACCTGGTTCCCCTGATAGAGCGGCTGGGGACGCCTCAG CAAATCGCCATCGCTCGG

GAGGGTGACCTGCTGACCAAGGAGCGGCTCTGCTGCGGCCTGTCCATGTTTGAGGTCATCCTGACCCGAATCCGGAGCTACCTGCAGGACCCCATCTGGA

GGGGCCCGCCACCCACCAATGGCGTCATGCATGTGGATGAGTGTGTGGAGTTTCACCGGCTGTGGAGTGCCATGCAGTTTGTCTACTGTATCCCTGTGGG

GACCAACGAGTTCACAGCTGA GCAGTGCTTCGGTGACGGCTTGAACTGGGCCGGCTGCTCCATCATTGTCTTGCTGGGCCAGCAGCGGCGCTTTGACCT

GTTTGACTTCTGTTATCATCTGCTGAAGGTGCAGAGGCAGGACGGGAAGGATGAGATCATTAAGAATGTG - UNI3119 - CCTCTGAAGAAGATGGC

TGACCGCATCAGGAAGTACCAGATCTTGAACAATGAGGTTTTTGCCATCCTGAACAAGTACATGAAGTCTGTAGAGACAGACAGTTCCACCGTAGAGCAT

GTGCGCTGCTTCCAGCCCCCAATCCACCAGTCATTGGCCACCACCTGCTAGGTAGAAAACCGTGCAGACCTTCAACCTGGAGGAGGAGGAGGAGGAGGAG

AGAACACAGTGACCAGCCTGCAGCAGGTCCAGTTGACAGTGTGTGGACAGGTCTGGAAGGAAAAGAAAACCTCCCCAACACATCTCTACCACTCCCAAGG

GCTGGGCTCCCGCATGTTCCTCCCATGATATCTCCATGGTGGATTTTCCATAGTGTAAATGAAAAAAAAAACAACAAAAACACAGGGCAGTGTGTGCTTT

CTTTTCTTTTTTTCCACCTTATCTGTATTGAAGAGCTACTGTTTCCACCCTGCAGCTGCCCACTCCATCTGCGATTACTTCCCAAGACCGCCTCCCCAAG

TCGTAACCTCCTACCCGCTATCTGTATTTGATCCAGCACTATAGTCTTAGAGACATAGAAGAGAAGAGTGTAGCCATAGCAGAGATATCAGCCTGGCCCA

TTGGATATCTCAGCTTACTGGCCCATCTTCTGTGGCTTCTCCCTCCAGTTCCCTCACCACAGCACTTCCTGCTCGTGACATTAGGGATTCCACCACCAAA

ATCTGATCCCTGGTGAACCAGGAAGAGGTTGCTGTTGTCAAGACAACAGATGATGCTGACCAAGATCTTTTACAGCCTCCCTAAGACCCACCCTAGACCT

TCCTTACAGAACAGACCTAGAGAGAAGAAAGTAAGGCTTGCAAAACCACACCACACTGGGTGGAACTAGGTGAAGATGACCAGGCCTACTGTGAGGGAGA

GAGAGAGTCATCAGCACAGGGCAAAACTCCAGATCCAAAGGATAAATGTTAGGCCTTGTTAACAGCGTGGGAAGATGAGGCACTCCTGGTCCTCAAACAG

AGGCTTAGCACTGAGCCACATGGGAATCCACATGGTCCGTCATAGCGCTACACATAGCATTCGTGAGTGACCAAGTCAGTGGCTGCTTAACACAGAACCT

AATCCAGGAAAATCCCCCAAGAAAGAAAACCTAAAGGGGTTACCTTAATTGGAGACAGGGTGGCAAGGAGGAAAAATATTTTTGTCAACAAGCTTCCTAT

CCCCAGACCCCTCCCCTCAAAAGGAAGTCTTCTTTGAGCTAACTGGAATGTTCTCATGTCGGCTACTAAAAGATTCTTGGAATGTTCTTTTGCTCTCAAT

GTCCTGGTCTCTCCCTTTTGCTCAAGCTCAGTCATGGGGATGTATTAACTTCTATGTTTCAGACTAAAACACCCCTGCACAGTCCCCACAAATAGCACAT

CTTTTAAAGAGATTGCCCAAGTCTCCATATAGAGCTAGTCATCTGACCTGCAGAGAGGACATAGCCCTGAGCTCCCAAGACACAGGAATAATAGATATTC

CTCTACCAGCCTGGGGAGGACAGAAGACAGGAGTAACCATCCCCTGCCCCAGGAAGGTGATTGTTATCCATCACCGTTTTTTTAACCACACAGAGAAGAG

AAGAGATGTGCATAATCTGTACTTTGCCAGACAGGGCCATGTACCCCAGGGTGGTCATATAAATTAGAATCCTTAAGGATGGCACACCAGAGTGTTCCTT

TCTGGACACTAACTTTGAATCTCTGGGAATAGAGCCAGAAGACCTGCCTCTTCTCAGATATATCACTGCACACCACATACTCAGACCTTGCTGTAGATTG

GACAACTCTACTAACTCTGGGTCTCTCTGAGCAAGAGTAGGAGCATTTGTAGTGTAGGGTTGTGGTTTGAAACAGAAACTGTCCAGTCCTCCTGTCTGGC

ACTGTTAATTCTTAGTCTGATTATTTTTCAATGACCATAGCTGTATCCCAGAGGCAGATTCCACTTTCCAGATCGTCAGCTCTGGCTGGGGATAGAATGT

GATAAACAGACTTTCCCCGCTTAGTGTCCCCTCACTGCTCTGTAGAGATTTGGGCTGTTCATAAGGCCGCCTTCCTGGCAGCTCATCCCTTCTACCCTGC

ACTCCTGACCCCAACAGTTGACCCTCTGGGAAGAGTCACATTCTGCTCAAGATATTTGATCCCAATAAATTGAGGTCCTCGCTTTGAGGACAGAGATTCC

ATTTTTGCAGCACTTGCCTGCAAACTCTGGACAACTTCAATGCTCTTTCCTCTCTAGTGGTCCTTGCCCCCCACCCCTTTGATTTTTTTTTTAATGTATT

TAAAGATCAAGAAAAAAGCTTAGATTTTAAAATGTTTTAAAAAGAATTCTGTTTCAGAAATTGTCAAATGTGTACCATATTTGTATTAAGAGTTGTTGGG

GATTTTTTGTACAATGAATTTACATTTATTTATGGTGAACTTATATTTACGCTTGTGATCAAATAATGATGTTAAATTCTTAAATCCTATTTGCTATGCA

GCTGAAGATGATATTTTGATTTGTATTTTGGGGGTACCTGTGTTGAGTCGATAAAACATTTTCATCTCCATTAAAACTGCTTCCAAACCAGTT
Translation
 MTTHVTLEDALSNVDLLEELPLPDQQPCIEPPPSSIMYQ ANFDTNFEDRNAFVTGIARYIEQATVHSSM NEMLEEGHDYAVMLYTWRSCSRAIPQ V

KCNEQPNRVEIYEKTVEVLEPEVTKLMKFMYFQ RKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCSVKNDHSAYKR RAAQ

FLRKMADPQSIQESQNLSMFLANHNRITQ CLHQQLEVIPGYEELLADIVNICVDYYENKMYLTPSEKHMLLK VMGFGLYLMDGNVSNIYKLDAKKRIN

LSKIDKFFK QLQVVPLFGDMQIELARYIKTSAHYEENKSK KWTCTQSSISPQYNICEQMVQIRDDHIRFISELARYSNSE VVTGSGLDSQKSDEEYR

ELFDLALRGLQLLSKWSAHVMEV YSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEKFAFVE VIAMIKGLQVLMGRMESVFNQAIRNTIYAALQD

FAQVTLREPLRQAVRKKKNVLIS SVLQAIRKTICDWEGGREPPNDPCLRGEKDPKGGFDIKVPRRAVGPSSTQ LYMVRTMLESLIADKSGSKKTLRSS

LDGPIVLAIEDFHKQSFFFTHLLNISE EALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMME EYVLYPLDLYNDSAYYAL

TKFKKQFLYDEIEAE VNLCFDQFVYKLADQIFAYYKAMAGS SVLLDKRFRAECKNYGVIIPYPPSNRYETLLKQRHVQ LLGRSIDLNRLITQRISAA

MYKSLDQAISRFESEDLTSIV ELEWLLEINRLTHRLLCKHMTLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNR RFVRTAIPFT

QEPQRDKPANVQPYYLYGSK PLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKIVKSL LQGTILQYVKTLIEVMPKICRLPRHEYGSP

G GILEFFHHQLKDIIEYAELKTDVFQSLREVGNAILFCLLIEQAL SQEEVCDLLHAAPFQNILPRVYIKE EGERLEVRMKRLEAKYAPLHLVPLIER

LGTPQ QIAIAREGDLLTKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTNGVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAE EQCFGDGLNWAGC

SIIVLLGQQRRFDLFDFCYHLLKVQRQDGKDEIIKNV - UNI3119 - PLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTVEHVRCFQPPIHQS

LATTC

For any suggestions or comments, please send an email to unitrap@crg.es