Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020358 (Hnrpab)
Chromosomal location
Chr 11: 51413602 - 51420349 (-)
Description
heterogeneous nuclear ribonucleoprotein A/B Gene [Source:MGI (curated);Acc:Hnrpab-003]
RefSeq_dna
NM_010448 
RefSeq_peptide
NP_034578.1 NP_001041526.1 
UniGene
Mm.280842 
MGI
MGI:1330294 
Uniprot/SWISSPROT
Q99020 
Uniprot/SPTREMBL
Q80XR6 Q9D6G1 Q544Z3 Q20BD0 Q3TMZ8 Q8CIR3 
Human Ortholog
ENSG00000197451 (HNRNPAB)
Omim not available
UniTrap UNI23353
Vector Insertion
Chr 11: 51419132 - 51419841
Public Clones IST14933F11 (tigm)
Private Clones OST262576 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26754
Vector Insertion
Chr 11: 51418320 - 51418962
Public Clones (sanger)
Private Clones OST99640 (lexicon) OST74176 (lexicon)
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4615
Vector Insertion
Chr 11: 51416198 - 51417901
Public Clones AV0462 (sanger) CSI845 (baygenomics) CSI263 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI42
Vector Insertion
Chr 11: 51415393 - 51416094
Public Clones GC0296 (tigem) DA0042 (sanger) CSI824 (baygenomics) RRS341 (baygenomics)
CSI512 (baygenomics) Ex166 (baygenomics) YTC446 (baygenomics) BGB002 (baygenomics)
PST5069-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI58
Vector Insertion
Chr 11: 51414370 - 51414981
Public Clones GC0317 (tigem) GC0438 (tigem) CSI498 (baygenomics) IST14947D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15743
Vector Insertion
Chr 11: 51414370 - 51415393
Public Clones PST728-1 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101249
Sequence
AGGCGGTGGCACCGCGCGGGACGGAGTTAAGGTCTTCTTTATCGGCAGTGTACGGCGGCGGCCGAGCGGAGCGATAGTCAGTGGCTGCGGACGAGCCCTC

GGGGGTGCGAGCGTGACCGCGGCCAAGCCCGCGCGTCGCCTTCTGCGGCGAGTAGGGCCTCGCGGCGTCATCGGCGGCGAG TAGCCGCTGCGGCCTGGC

CGACCATGTCGGACGCGGCTGAGGAGCAGCCCATGGAGACGACGGGCGCCACCGAGAACGGACACGAGGCCGCCCCCGAAGGCGAGGCCCCGGTCGAGCC

CAGCGCGGCTGCCGCGGCCCCCGCGGCCTCGGCCGGGTCTGGGGGCGGGACCACGACCGCACCGAGCGGGAACCAGAACGGCGCGGAGGGCGACCAGATC

AACGCCAGCAAGAACGAGGAGGACGCGGG - UNI23353 - AAAAATGTTCGTTGGTGGTCTGAGCTGGGATACCAGCAAAAAAGACTTAAAGGATTA

TTTTACTAAGTTTGGAGAGGTTGTTGACTGTACAATAAAAATGGATCCCAACACTGGACGATCAAGAGGGTTTGGGTTTATTCTCTTCAAAGATTCTTCT

AGTGTGGAAAAG - UNI26754 - GTCTTAGATCAGAAGGAGCACAGGCTGGATGGTCGTGTCATTGACCCTAAAAAGGCTATGGCTATGAAGAAGGA

CCCTGTGAAGAAAATCTTTGTGGGAGGTCTAAACCCTGAAGCCACAGAGGAAAAGATCAGAGAATACTTCGGCCAGTTTGGGGAG ATTGAGGCCATTGA

GCTTCCAATAGATCCCAAGTTGAACAAAAGACGGGGTTTTGTTTTTATTACATTTAAAGAGGAAGATCCTGTGAAGAAAGTTCTGGAGAAGAAATTTCAT

ACTGTCAGTGGAAGCAAG - UNI4615 - TGTGAAATCAAGGTTGCCCAGCCCAAAGAGGTGTATCAGCAACAGCAGTATGGCTCTGGGGGCAGAGGA

AATCGCAATCGAGGGAACCGAGGCAGTGGTGGAG - UNI42 - - UNI15743 - GTCAGAGTCAGAGTTGGAATCAGGGCTACGGCAACTACTGGA

ACCAGGGCTACGGCTACCAGCAGGGCTACGGGCCGGGCTATGGCGGCTACGACTACTCGCCCTATGGCTATTACGGCTACGGCCCCGGCTACGACTACAG

TAAGTAGGAGAGGGAGGCCCTATCTACTTCCTCCTAGGGGAGGCAGGTTAGGTAGTGCAGGGGCCATTGGCAGCAGGGGCTTTGGAGTCAGACAGGCCTG

GCACAGGCACTGGAGCTACTGAATGAAGCTCTAGCTTAGCCTTCTCAGTAAGGTGTAAGAAGCTGGTGTTGCTGTGTAGTGTTAATTTATTCTGAGGATG

TGTGGCAAGCGCCTGGCACTGGGTAAATGTATAGTTAAAGTAGTAGCCACAACGTTGTTCTTATTCCTAGGTCAGGGTAGTACAAATTACGGAAAGAGCC

AGCGACGTGGTGGTCATCAGAATAACTACAAGCCATACTGAGAGGCAGCAGGAGCGGCCGAGTGACGACCGCACACGCTTTGTTTGGACGCGGAGTGAAC

ACAATTATGTACCAAATTTAACTTGGCAAACTTTTATGGCCTGTCCCATGTGCATCTTATTTAAAATTTCCCCCAGAAATCACTCTCCTGTTTACTATTC

CAGAGCTCTAGTTGTAGGCAGCGTGTGGCGTCTCAGAGGCCAGAGCGGCACTAGGGGGCTGATTTTATTACCAGGTTACCCTGTTCTAGATCAGGAGGGT

CTATTTCCTGTTGCCGCTCTGCAGCCTGGACCTGTGGACCCTGGTTGTAAAGAGTAAAACTGTATCTTAGGAAACCAGTGTCACCTTTTTCACCTTTTAA

TTTTATATTATTTGTGTCATACATTTCCAGTAATGGAAGTGTTAATTTTACTGTACTTTTTGGTACCTTTTGGGAATCTAATGTATTGTAAGGTATTTTA

CACGTGTCCTGATTTTGCCACGACCTGGATATTGAAGCTATCCAAGCTTTTGAAATAAAAATGAAAAACAAAACCCCCAA
Translation
 MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSAAAAAPAASAGSGGGTTTAPSGNQNGAEGDQINASKNEEDAG - UNI23353 - GKMFVGGLSW

DTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEK - UNI26754 - VLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEA

TEEKIREYFGQFGE IEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSK - UNI4615 - CEIKVAQPKEVYQQQQYGSGGRGNRNRG

NRGSGGG - UNI42 - - UNI15743 - GQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSK
Transcript ENSMUST00000074669
Sequence
AGGCGGTGGCACCGCGCGGGACGGAGTTAAGGTCTTCTTTATCGGCAGTGTACGGCGGCGGCCGAGCGGAGCGATAGTCAGTGGCTGCGGACGAGCCCTC

GGGGGTGCGAGCGTGACCGCGGCCAAGCCCGCGCGTCGCCTTCTGCGGCGAGTAGGGCCTCGCGGCGTCATCGGCGGCGAG TAGCCGCTGCGGCCTGGC

CGACCATGTCGGACGCGGCTGAGGAGCAGCCCATGGAGACGACGGGCGCCACCGAGAACGGACACGAGGCCGCCCCCGAAGGCGAGGCCCCGGTCGAGCC

CAGCGCGGCTGCCGCGGCCCCCGCGGCCTCGGCCGGGTCTGGGGGCGGGACCACGACCGCACCGAGCGGGAACCAGAACGGCGCGGAGGGCGACCAGATC

AACGCCAGCAAGAACGAGGAGGACGCGGG - UNI23353 - AAAAATGTTCGTTGGTGGTCTGAGCTGGGATACCAGCAAAAAAGACTTAAAGGATTA

TTTTACTAAGTTTGGAGAGGTTGTTGACTGTACAATAAAAATGGATCCCAACACTGGACGATCAAGAGGGTTTGGGTTTATTCTCTTCAAAGATTCTTCT

AGTGTGGAAAAG - UNI26754 - GTCTTAGATCAGAAGGAGCACAGGCTGGATGGTCGTGTCATTGACCCTAAAAAGGCTATGGCTATGAAGAAGGA

CCCTGTGAAGAAAATCTTTGTGGGAGGTCTAAACCCTGAAGCCACAGAGGAAAAGATCAGAGAATACTTCGGCCAGTTTGGGGAG ATTGAGGCCATTGA

GCTTCCAATAGATCCCAAGTTGAACAAAAGACGGGGTTTTGTTTTTATTACATTTAAAGAGGAAGATCCTGTGAAGAAAGTTCTGGAGAAGAAATTTCAT

ACTGTCAGTGGAAGCAAG - UNI4615 - TGTGAAATCAAGGTTGCCCAGCCCAAAGAGGTGTATCAGCAACAGCAGTATGGCTCTGGGGGCAGAGGA

AATCGCAATCGAGGGAACCGAGGCAGTGGTGGAG - UNI42 - - UNI58 - - UNI15743 - GTCAGGGTAGTACAAATTACGGAAAGAGCCAG

CGACGTGGTGGTCATCAGAATAACTACAAGCCATACTGAGAGGCAGCAGGAGCGGCCGAGTGACGACCGCACACGCTTTGTTTGGACGCGGAGTGAACAC

AATTATGTACCAAATTTAACTTGGCAAACTTTTATGGCCTGTCCCATGTGCATCTTATTTAAAATTTCCCCCAGAAATCACTCTCCTGTTTACTATTCCA

GAGCTCTAGTTGTAGGCAGCGTGTGGCGTCTCAGAGGCCAGAGCGGCACTAGGGGGCTGATTTTATTACCAGGTTACCCTGTTCTAGATCAGGAGGGTCT

ATTTCCTGTTGCCGCTCTGCAGCCTGGACCTGTGGACCCTGGTTGTAAAGAGTAAAACTGTATCTTAGGAAACCAGTGTCACCTTTTTCACCTTTTAATT

TTATATTATTTGTGTCATACATTTCCAGTAATGGAAGTGTTAATTTTACTGTACTTTTTGGTACCTTTTGGGAATCTAATGTATTGTAAGGTATTTTACA

CGTGTCCTGATTTTGCCACGACCTGGATATTGAAGCTATCCAAGCTTTTGAAATAAAAATGAAAAACAAAACCCCCAAGCCTGGGTAAATGTGGGATGCT

CTGTGAGACCTTGCCCAGTGTTGGAGATGCCAGGTCTCCTGTAGCAAAGCAGAGGTCCTTTAGTTATCCCATCTGATCTTTTTAGCTGCCCTTTTGTGCC

CATTGTCTCCATAGCAGAGACCATCTTGCCATGTATTATATATATTCCATGTTCTTAGTTTCAGTCAAGTACAAGTTGAAATGTTGGGGATCTGCTGATG

GAGGTGGGGCCAAGTCTGGCTTACCTGGGGGGTGCTTGATCCTCAGGGTTTCACAACTTCTTACTTTTTCTTCCATGTCTGGAAAATGATCACAGATCGT

TTCTTTTTCCCCCCAAGACAGGGTTTCTCTGTAGCCCTGGTTAGGTTATCCTGGAACTCTGTAGACCAGGCTGGCCTTGAACTCAGAAATCCACCTGGCT

CTGCCTCCCAAGTGCTGGGATTAAAGGCGTGCGCCACCACGCCTGGCCTACCCTCAGTTTCTAAGATGCTTGGGATAGTTTAGAGATTGGCTTATGTCTC

ATCATTTCCCTAGCACAGATGGTCCCTTTGTAAGCCCAGTCACCACTCACTGTTCTGTACACATAGAACCCTCTAAGAAATGTATCAATTCCAAAACGCA

GTAGGGGTGGCTAACAAGCAGGAATAGGAAGGGATCCTTGGTAGCTTGTTTTTTGTCTGTTGGGATCTGAGCTTTGTATAACAACCACTTTGGTGTATAG

TCATTTCTAGTTCGGTAGTTTTCTTAAATAAATTGAGGGAGACCTTG
Translation
 MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSAAAAAPAASAGSGGGTTTAPSGNQNGAEGDQINASKNEEDAG - UNI23353 - GKMFVGGLSW

DTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEK - UNI26754 - VLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEA

TEEKIREYFGQFGE IEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSK - UNI4615 - CEIKVAQPKEVYQQQQYGSGGRGNRNRG

NRGSGGG - UNI42 - - UNI58 - - UNI15743 - GQGSTNYGKSQRRGGHQNNYKPY
Transcript ENSMUST00000109103
Sequence
AGGCGGTGGCACCGCGCGGGACGGAGTTAAGGTCTTCTTTATCGGCAGTGTACGGCGGCGGCCGAGCGGAGCGATAGTCAGTGGCTGCGGACGAGCCCTC

GGGGGTGCGAGCGTGACCGCGGCCAAGCCCGCGCGTCGCCTTCTGCGGCGAGTAGGGCCTCGCGGCGTCATCGGCGGCGAG TAGCCGCTGCGGCCTGGC

CGACCATGTCGGACGCGGCTGAGGAGCAGCCCATGGAGACGACGGGCGCCACCGAGAACGGACACGAGGCCGCCCCCGAAGGCGAGGCCCCGGTCGAGCC

CAGCGCGGCTGCCGCGGCCCCCGCGGCCTCGGCCGGGTCTGGGGGCGGGACCACGACCGCACCGAGCGGGAACCAGAACGGCGCGGAGGGCGACCAGATC

AACGCCAGCAAGAACGAGGAGGACGCGGG - UNI23353 - AAAAATGTTCGTTGGTGGTCTGAGCTGGGATACCAGCAAAAAAGACTTAAAGGATTA

TTTTACTAAGTTTGGAGAGGTTGTTGACTGTACAATAAAAATGGATCCCAACACTGGACGATCAAGAGGGTTTGGGTTTATTCTCTTCAAAGATTCTTCT

AGTGTGGAAAAG - UNI26754 - GTCTTAGATCAGAAGGAGCACAGGCTGGATGGTCGTGTCATTGACCCTAAAAAGGCTATGGCTATGAAGAAGGA

CCCTGTGAAGAAAATCTTTGTGGGAGGTCTAAACCCTGAAGCCACAGAGGAAAAGATCAGAGAATACTTCGGCCAGTTTGGGGAG ATTGAGGCCATTGA

GCTTCCAATAGATCCCAAGTTGAACAAAAGACGGGGTTTTGTTTTTATTACATTTAAAGAGGAAGATCCTGTGAAGAAAGTTCTGGAGAAGAAATTTCAT

ACTGTCAGTGGAAGCAAG - UNI4615 - TGTGAAATCAAGGTTGCCCAGCCCAAAGAGGTGTATCAGCAACAGCAGTATGGCTCTGGGGGCAGAGGA

AATCGCAATCGAGGGAACCGAGGCAGTGGTGGAG - UNI42 - - UNI15743 - GTCAGAGTCAGAGTTGGAATCAGGGCTACGGCAACTACTGGA

ACCAGGGCTACGGCTACCAGCAGGGCTACGGGCCGGGCTATGGCGGCTACGACTACTCGCCCTATGGCTATTACGGCTACGGCCCCGGCTACGACTACA 

- UNI58 - - UNI15743 - GTCAGGGTAGTACAAATTACGGAAAGAGCCAGCGACGTGGTGGTCATCAGAATAACTACAAGCCATACTGAGAGGCA

GCAGGAGCGGCCGAGTGACGACCGCACACGCTTTGTTTGGACGCGGAGTGAACACAATTATGTACCAAATTTAACTTGGCAAACTTTTATGGCCTGTCCC

ATGTGCATCTTATTTAAAATTTCCCCCAGAAATCACTCTCCTGTTTACTATTCCAGAGCTCTAGTTGTAGGCAGCGTGTGGCGTCTCAGAGGCCAGAGCG

GCACTAGGGGGCTGATTTTATTACCAGGTTACCCTGTTCTAGATCAGGAGGGTCTATTTCCTGTTGCCGCTCTGCAGCCTGGACCTGTGGACCCTGGTTG

TAAAGAGTAAAACTGTATCTTAGGAAACCAGTGTCACCTTTTTCACCTTTTAATTTTATATTATTTGTGTCATACATTTCCAGTAATGGAAGTGTTAATT

TTACTGTACTTTTTGGTACCTTTTGGGAATCTAATGTATTGTAAGGTATTTTACACGTGTCCTGATTTTGCCACGACCTGGATATTGAAGCTATCCAAGC

TTTTGAAATAAAAATGAAAAACAAAACCCCCAAGCCTGGGTAAATGTGGGATGCTCTGTGAGACCTTGCCCAGTGTTGGAGATGCCAGGTCTCCTGTAGC

AAAGCAGAGGTCCTTTAGTTATCCCATCTGATCTTTTTAGCTGCCCTTTTGTGCCCATTGTCTCCATAGCAGAGACCATCTTGCCATGTATTATATATAT

TCCATGTTCTTAGTTTCAGTCAAGTACAAGTTGAAATGTTGGGGATCTGCTGATGGAGGTGGGGCCAAGTCTGGCTTACCTGGGGGGTGCTTGATCCTCA

GGGTTTCACAACTTCTTACTTTTTCTTCCATGTCTGGAAAATGATCACAGATCGTTTCTTTTTCCCCCCAAGACAGGGTTTCTCTGTAGCCCTGGTTAGG

TTATCCTGGAACTCTGTAGACCAGGCTGGCCTTGAACTCAGAAATCCACCTGGCTCTGCCTCCCAAGTGCTGGGATTAAAGGCGTGCGCCACCACGCCTG

GCCTACCCTCAGTTTCTAAGATGCTTGGGATAGTTTAGAGATTGGCTTATGTCTCATCATTTCCCTAGCACAGATGGTCCCTTTGTAAGCCCAGTCACCA

CTCACTGTTCTGTACACATAGAACCCTCTAAGAAATGTATCAATTCCAAAACGCAGTAGGGGTGGCTAACAAGCAGGAATAGGAAGGGATCCTTGGTAGC

TTGTTTTTTGTCTGTTGGGATCTGAGCTTTGTATAACAACCACTTTGGTGTATAGTCATTTCTAGTTCGGTAGTTTTCTTAAATAAATTGAGGGAGACCT

TG
Translation
 MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSAAAAAPAASAGSGGGTTTAPSGNQNGAEGDQINASKNEEDAG - UNI23353 - GKMFVGGLSW

DTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEK - UNI26754 - VLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEA

TEEKIREYFGQFGE IEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSK - UNI4615 - CEIKVAQPKEVYQQQQYGSGGRGNRNRG

NRGSGGG - UNI42 - - UNI15743 - GQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYS - UNI58 - - UNI15743

 - SQGSTNYGKSQRRGGHQNNYKPY

For any suggestions or comments, please send an email to unitrap@crg.es