Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020368 (Canx)
Chromosomal location
Chr 11: 50107971 - 50139093 (-)
Description
calnexin Gene [Source:MGI (curated);Acc:Canx-001]
RefSeq_dna
NM_007597 
RefSeq_peptide
NP_001103969.1 NP_001103970.1 NP_031623.1 
UniGene
Mm.248827 Mm.399579 Mm.405019 
MGI
MGI:88261 
Uniprot/SWISSPROT
P35564 
Uniprot/SPTREMBL
Q3TXE5 Q5SUC3 
Human Ortholog
ENSG00000127022 (CANX)
Omim not available
UniTrap UNI6711
Vector Insertion
Chr 11: 50125287 - 50138994
Public Clones (sanger) XK392 (baygenomics) XH148 (baygenomics) HMA568 (baygenomics)
M019B05 (ggtc) D015H07 (ggtc) P092A01 (ggtc) P118A02 (ggtc) M038A03 (ggtc)
D048F02 (ggtc) P009E09 (ggtc) P097C10 (ggtc) M022E01 (ggtc) P111E07 (ggtc)
W194F02 (ggtc) D134H09 (ggtc) PST174-3 (escells) PST8694-NR (escells)
PST1019-2 (escells) IST14267E8 (tigm) IST14391C11 (tigm) IST14675B5 (tigm)
IST14774B8 (tigm)
Private Clones OST304322 (lexicon) OST292483 (lexicon) OST261970 (lexicon) OST207970 (lexicon)
OST197595 (lexicon) OST171991 (lexicon) OST119397 (lexicon) OST60665 (lexicon)
OST49730 (lexicon) OST42194 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11295
Vector Insertion
Chr 11: 50121894 - 50122289
Public Clones P072D12 (ggtc) G070F04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6967
Vector Insertion
Chr 11: 50118018 - 50120971
Public Clones PST097 (baygenomics) KST286 (baygenomics) G044E06 (ggtc)
Private Clones OST55059 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10598
Vector Insertion
Chr 11: 50115374 - 50117827
Public Clones P076G01 (ggtc) P069H09 (ggtc) P070A06 (ggtc) P069H06 (ggtc) CMHD-GT_330B6-3 (cmhd)
Private Clones OST449380 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10615
Vector Insertion
Chr 11: 50114557 - 50115259
Public Clones P069B01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27922
Vector Insertion
Chr 11: 50110640 - 50110775
Public Clones not available
Private Clones OST43906 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37143
Vector Insertion
Chr 11: 50109838 - 50110559
Public Clones CMHD-GT_542B7-5S (cmhd) CMHD-GT_542B7-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020637
Sequence
GGTCGGGCCGCCTCTGCCGCTGTCTCCACTGCAGCACGGGGCCGGGTGTGCGGGTGGGAGAAGGTGAGGGAGCCGCCAGTGGTCCCCGGGAGGCTCGAG 

- UNI6711 - ATAGATCATGGAAGGGAAGTGGTTACTGTGTTTGCTGCTGGTCCTTGGAACTGCAGCTGTTGAGGCTCATGATGGACATGATGATGAC

GCGATTGATATTGAAGATGATCTTGATGATGTTATTGAAGAGGTAGAAGATTCAAAATCTAAATCAGATGCCAGCACTCCTCCATCTCCAAAG GTCACC

TACAAAGCTCCAGTTCCAACAGGGGAGGTTTATTTTGCTGACTCCTTTGACAGAGGGTCTCTGTCAGG GTGGATTTTATCTAAAGCCAAAAAAGATGAC

ACTGATGATGAAATTGCCAAATATGATG GAAAGTGGGAAGTAGATGAGATGAAGGAAACAAAGCTTCCAGGGGATAAAGGACTTGTACTGATGTCTCGG

GCCAAGCATCATGCCATCTCTGCTAAACTGAATAAGCCCTTCCTGTTTGATACCAAGCCTCTCATTGTTCA - UNI11295 - GTATGAGGTTAATTT

TCAGAATGGAATAGAATGTGGTGGTGCCTATGTGAAGCTGCTTTCCAAGACGGCAGAGCTCAGCCTG GATCAATTCCACGACAAGACTCCCTATACTAT

TATGTTTGGTCCAGATAAGTGTGGAGAGGACTACAAACTGCATTTCATCTTTCGACACAAAAATCCCAAGACAGGTGTATATGAAGAAAAACATGCTAAG

AGGCCAGATGCAGATCTGAAGACCTATTTCACTGACAAGAAAACGCATCTTTATACATTAA - UNI6967 - TCTTGAATCCAGACAATAGTTTTGAA

ATATTAGTTGACCAGTCTGTTGTGAACAGTGGAAATCTGCTAAATGACATGACTCCTCCTGTAAACCCTTCACGTGAAATTGAAGACCCAGAAGACCGGA

AGCCTGAAGATTGGGATGAAAGGCCCAAAATAGCAGATCCAGATGCTGTCAAGCCAGATGACTG - UNI10598 - GGATGAAGACGCCCCTTCTAAG

ATCCCAGATGAAGAGGCCACCAAGCCTGAAGGCTGGCTAGACGACGAACCTGAGTATATTCCAGACCCTGATGCAGAGAAGCCAGAGGATTG - UNI10

615 - GGATGAGGATATGGACGGAGAATGGGAGGCTCCTCAGATTGCCAACCCCAAGTGTGAGTCAGCCCCTGGGTGTGGTGTCTGGCAGCGACCTATG

ATTGACAACCCCAATTATAAGGGCAAATGGAAGCCTCCAATGATTGACAACCCTAACTACCAG GGAATCTGGAAACCAAGGAAAATACCAAATCCAGAT

TTCTTTGAAGACCTAGAACCTTTTAAGATGACTCCTTTCAGTGCTATTGGTTTGGAGCTCTGGTCCATGACATCCGACATCTTTTTTGACAACTTTATCA

TTAGTGGTGACCGAAGAGTAGTTGATGATTGGGCCAATGATGGGTGGGGCCTGAAGAAAGCTGCTGATGGGGCTGCTGAG CCAGGTGTAGTGCTGCAGA

TGCTGGAGGCAGCTGAAGAGCGTCCATGGCTTTGGGTGGTCTACATTTTGACTGTAGCTTTGCCAGTGTTCCTTGTGATCCTCTTCTGCTGTTCTGGAAA

G AAACAGTCCAATGCTATGGAGTACAAGAAGACGGATGCTCCCCAGCCAGATGTGAAGGATGAAGAAGGGAAGGAAGAAGAGAAGAACAAGAGGGATGA

AGAGGAAGAAGAGGAGAAGCTTG - UNI27922 - AAGAGAAACAGAAGAGTGATGCTGAAGAAGATGGTGTTACTGGCAGTCAAGATGAGGAAGATA

GCAAGCCTAAAGCAGAG GAGGATGAAATTTTGAACAGATCGCCAAGAAACAGAAAGCCACGAAGAGAGTGAAACAATCTTTAAGAACTTGATCTGTGAT

TTCCTCTCCCTCCCCTTCCCCTGCAAATGTGGTCCTAGGAGAGGGCCTGGTGTACCTTAGGTGGGAGCTCAAAACCTCAAGATGTCACCATCAACAGGTT

CCAGTGAATACTAGCCTGTAATTTTAAACATCTAGCAGTAAATAATTGCAGTTGTAATGTAAAGGACCCTGTTTCTGTAGAAAGGAAAACATTTAACATA

ATGGTTGTGAAATGTAACATGAAGCAACTAACTAGTGTTTTGTTGTTTTTAAAATTTTCCAGGTTTGTCTTTTTTTTTTTCCTTTTCCTTTTTTTTTTTT

TTTTAGATACAATGATAGAATTTTTGCCAGTTTAAAATCTTGGCTTAATTTAATATATTCATTTGTTCATGCAGAAATAACACCAACATTAGGAATGCTA

GGGAGAATGAATTGCCGTTTTTATAATAACTTTTTTAAGTTTGGTATTAAAGCATTCATGTGTCTGTCCTAAAATTGTAATCACGTTCAAGTGCAGTTAT

TTGTGGTTATAAATCTTGTTTTGTGTGCTTCCATTAGTTAATTCCTCTTAAAGACACAAGAGCGATTGGATGGAAGCCCAAATTTATATCAAAGTTCCCT

TTACATTGTATTGAATAGACCCAAAAAGAACTAAAAGGAGACTTTGACTTGGTCATTTCACATCAGATCATAAAGTGCAGTGTTCTGTTGCCCTAGAGAC

TGCTCCATTCACAAGCACCTTTGAAGAGGGAAGGAGCTGGCTTCATGTAGCAGTTCATACTGTACTTCCCACATAGGAGGTCTGACAGCTCGGGTCCTCT

GGAGCACAAGGCTTTTTAAGGAATGCTGGTGGTGCCTGGGTAGATAATTACATCACTTGTTCCACTGTGTTGACACTGTTTTCCTCATGGATCTCCTCCA

TTCCTAGCTTTCTCTGCTATGCATTTTCTTCACAGCGCAGCTTGCGGTCCGTTGCTGAAAATTATAAGCTCTGCATAGTGTTGGCTTTACTGTGATGACA

TGTTTCTTCTTTTTTAGCTGGCCCACACCTTTCTAGGGTCCAACTACAGGATAGATTACAGACTTTCCATTAGTGTCTATTTCTTTTACTCTGTGTAGAC

TTTAGAAAGTCTAATCAATCCAGAGATGGGCCAATTCAGAATTGACTATAATTGAACACCTGCTAAAAGTATTTATGGGAGGATTGACACACAGCATGAG

TTATTTGACTTTTGTAGGATATTTAAAATCTTCATTTGCAGTTCATGTAACAGTTGTGTCTTAAAATTCACATAATAAAGCAGTCCTGTTCAAAAAAAAA

ATTTTTTTTTTGTGGCTTGTAGAATTTTTTAAAAGTGTATTTAGGGCTTTTTGTTTTTTGTTTGTTTTTTTGTTTTGTTTTTCATGTGGAATGCAGATGG

GTGCTAGAGGAGCCTCTCCCACATCACTATAGTGTAATATTATTACACCACACTGAAATGTATTCAGAAACAGATGTTTCAATTTCATTCTTTCTCCAGA

GGTGGTCCAGTTGTACCAATGATACTATTCCTTGCACTGAATATATATAAACACTCTTCAGTGTTTATATTGGGGAAATACTGGGAAAGAAATATATTTG

TTAAGGATGAAGGCTGTATCTGTTGTCTTTATAAACACTGGTTCATTTCTTTTGAGGGTGGAATGCATTTTTCTTCCTGTTCAGTGCTTTATCACCATCT

GTTGTTTGTGGTCACAGTGACCATAGCTATGTAGCGGACGTTTCCAAATGTATAGAGTGAAATAAACAGTTACTAGCAAGAAATG
Translation
 - UNI6711 - MEGKWLLCLLLVLGTAAVEAHDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPK VTYKAPVPTGEVYFADSFDRGSLSG GW

ILSKAKKDDTDDEIAKYDG GKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQ - UNI11295 - QYEVNFQNGIECGGAYVK

LLSKTAELSL DQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLI - UNI6967 - ILNPDNSFEIL

VDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDW - UNI10598 - WDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDA

EKPEDW - UNI10615 - WDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQ GIWKPRKIPNPDFFEDLEPFKMTPFS

AIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAE PGVVLQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGK KQSNAMEYKKTD

APQPDVKDEEGKEEEKNKRDEEEEEEKLE - UNI27922 - EEKQKSDAEEDGVTGSQDEEDSKPKAE EDEILNRSPRNRKPRRE

For any suggestions or comments, please send an email to unitrap@crg.es