Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020376 (Rnf130)
Chromosomal location
Chr 11: 49838848 - 49918260 (+)
Description
ring finger protein 130 Gene [Source:MGI (curated);Acc:Rnf130-002]
RefSeq_dna
NM_021540 
RefSeq_peptide
NP_067515.2 
MGI
MGI:1891717 
Uniprot/SWISSPROT
Q8VEM1 
Uniprot/SPTREMBL
Q5DTJ1 Q5SVR5 
Human Ortholog
ENSG00000113269 (RNF130)
Omim not available
UniTrap UNI17487
Vector Insertion
Chr 11: 49839150 - 49866277
Public Clones (cmhd)
Private Clones OST441844 (lexicon) OST405807 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000054684
Sequence
ACCGGCCCCGGAGCCCGGTCCGCGAGCGGCGGCGGCGGCGGCGGCCGGAGGGACCATGAGCGGCGCGGCGCGAGCGGGCCCGGCCCGGCTCGCGGCGCTG

GCCCTGCTGACTTGCAGCCTGTGGCCGACGCGAGCGGACAACGCGAGCCAGGAGTACTACACGGCGCTCATCAACGTGACGGTGCAGGAGCCCGGCCGCG

GCACCCCGCTCACGTTCCGCATCGACCGCGGGCGCTACGGGCTCGACTCACCCAAGGCCGAGGTCCGCGGCCAGGTGCTGGCACCGCTGCCCATCCACGG

AG - UNI17487 - TTGCTGATCATCTGGGCTGTGATCCTCAAACACGGTTCTTTGTCCCTCCTAATATCAAACAGTGGATCGCCTTGCTACAAAGAG

GAAATTGCACCTTTAAAGAGAAAATATCACGGGCTGCTTTTCACAATGCGGTTGCTGTAGTCATCTACAATAATAAATCCAAAGAGGAGCCGGTCACCAT

GACTCATCCAG GCACGGGAGATATTATTGCTGTCATGATAACAGAATTGAGGGGTAAGGATATTTTGAGTTATCTGGAGAAAAACATCTCTGTACAAAT

GACAATAGCTGTTGGAACTCGAATGCCGCCAAAGAACTTCAGCCGTGGCTCTCTAGTCTTCGTGTCAATCTCCTTTATTGTTTTGATGATTATTTCTTCA

GCGTGGCTCATATTCTACTTCATTCAGAAGATCAGGTACACAAATGCTCGGGACAGGAACCAG CGTCGTCTTGGAGACGCAGCCAAGAAAGCCATCAGT

AAATTGACAACTAGAACGGTGAAAAAGGGCGATAAG GAAACAGACCCAGACTTCGATCACTGTGCAGTCTGCATAGAAAGCTATAAGCAGAATGATGTT

GTTCGGGTTCTCCCCTGCAA GCATGTTTTCCACAAATCCTGTGTGGATCCCTGGCTCAGTGAACACTGTACCTGTCCTATGTGCAAACTTAATATTTTG

AAAGCCCTAGGAATTGTG CCAAATCTGCCATGTACTGATAATGTAGCCTTTGATATGGAAAGGCTGACCAGAACCCAAGCGGTTAACCGGAGAGCAGCC

CTTGGTGACCTTGCCGGTGACAGTTCCCTTGGCCTTGAGCCACTGAGAACTTCGGGGATATCGCCTCTTCCTCAAGATGGGGAGCTCACTCCTCGCACGG

GTGAAATCAACATTGCAGTAACAA GGTAGAATGGTTTTGAAGAAGGAAAACACTGCTTTCTGACTGATTGCCTTGAAGGAAAAAAGAACCTATTTTTGT

GCATCATTTACCAATCATGCCACACAAGCGTTTATTTTTAGTACATTTTATTTTTTCATAAAATTGCTAATGCCAAAGCTTTGTATTAAAATAAATAAAT

AATAAAATAAAAGTACCGTGTTGCTAAGTATCCTT
Translation
MSGAARAGPARLAALALLTCSLWPTRADNASQEYYTALINVTVQEPGRGTPLTFRIDRGRYGLDSPKAEVRGQVLAPLPIHGV - UNI17487 - VAD

HLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPG GTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGT

RMPPKNFSRGSLVFVSISFIVLMIISSAWLIFYFIQKIRYTNARDRNQ RRLGDAAKKAISKLTTRTVKKGDK ETDPDFDHCAVCIESYKQNDVVRVLP

CK KHVFHKSCVDPWLSEHCTCPMCKLNILKALGIV PNLPCTDNVAFDMERLTRTQAVNRRAALGDLAGDSSLGLEPLRTSGISPLPQDGELTPRTGEI

NIAVTR R
Transcript ENSMUST00000102776
Sequence
CGGCCCCGGAGCCCGGTCCGCGAGCGGCGGCGGCGGCGGCGGCCGGAGGGACCATGAGCGGCGCGGCGCGAGCGGGCCCGGCCCGGCTCGCGGCGCTGGC

CCTGCTGACTTGCAGCCTGTGGCCGACGCGAGCGGACAACGCGAGCCAGGAGTACTACACGGCGCTCATCAACGTGACGGTGCAGGAGCCCGGCCGCGGC

ACCCCGCTCACGTTCCGCATCGACCGCGGGCGCTACGGGCTCGACTCACCCAAGGCCGAGGTCCGCGGCCAGGTGCTGGCACCGCTGCCCATCCACGGAG

 - UNI17487 - TTGCTGATCATCTGGGCTGTGATCCTCAAACACGGTTCTTTGTCCCTCCTAATATCAAACAGTGGATCGCCTTGCTACAAAGAGGA

AATTGCACCTTTAAAGAGAAAATATCACGGGCTGCTTTTCACAATGCGGTTGCTGTAGTCATCTACAATAATAAATCCAAAGAGGAGCCGGTCACCATGA

CTCATCCAG GCACGGGAGATATTATTGCTGTCATGATAACAGAATTGAGGGGTAAGGATATTTTGAGTTATCTGGAGAAAAACATCTCTGTACAAATGA

CAATAGCTGTTGGAACTCGAATGCCGCCAAAGAACTTCAGCCGTGGCTCTCTAGTCTTCGTGTCAATCTCCTTTATTGTTTTGATGATTATTTCTTCAGC

GTGGCTCATATTCTACTTCATTCAGAAGATCAGGTACACAAATGCTCGGGACAGGAACCAG CGTCGTCTTGGAGACGCAGCCAAGAAAGCCATCAGTAA

ATTGACAACTAGAACGGTGAAAAAGGGCGATAAG GAAACAGACCCAGACTTCGATCACTGTGCAGTCTGCATAGAAAGCTATAAGCAGAATGATGTTGT

TCGGGTTCTCCCCTGCAA GCATGTTTTCCACAAATCCTGTGTGGATCCCTGGCTCAGTGAACACTGTACCTGTCCTATGTGCAAACTTAATATTTTGAA

AGCCCTAGGAATTGTG CCAAATCTGCCATGTACTGATAATGTAGCCTTTGATATGGAAAGGCTGACCAGAACCCAAGCGGTTAACCGGAGAGCAGCCCT

TGGTGACCTTGCCGGTGACAGTTCCCTTGGCCTTGAGCCACTGAGAACTTCGGGGATATCGCCTCTTCCTCAAGATGGGGAGCTCACTCCTCGCACGGGT

GAAATCAACATTGCAGTAACAA AAGAATGGTTTATTATTGCCAGTTTTGGCCTCCTCAGTGCTCTCACACTCTGCTACATGATCATCAGAGCCACAGCT

AGCTTGAATGCTAATGA GGTAGAATGGTTTTGAAGAAGGAAAACACTGCTTTCTGACTGATTGCCTTGAAGGAAAAAAGAACCTATTTTTGTGCATCAT

TTACCAATCATGCCACACAAGCGTTTATTTTTAGTACATTTTATTTTTTCATAAAATTGCTAATGCCAAAGCTTTGTATT
Translation
MSGAARAGPARLAALALLTCSLWPTRADNASQEYYTALINVTVQEPGRGTPLTFRIDRGRYGLDSPKAEVRGQVLAPLPIHGV - UNI17487 - VAD

HLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPG GTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGT

RMPPKNFSRGSLVFVSISFIVLMIISSAWLIFYFIQKIRYTNARDRNQ RRLGDAAKKAISKLTTRTVKKGDK ETDPDFDHCAVCIESYKQNDVVRVLP

CK KHVFHKSCVDPWLSEHCTCPMCKLNILKALGIV PNLPCTDNVAFDMERLTRTQAVNRRAALGDLAGDSSLGLEPLRTSGISPLPQDGELTPRTGEI

NIAVTK KEWFIIASFGLLSALTLCYMIIRATASLNANE EVEWF

For any suggestions or comments, please send an email to unitrap@crg.es