Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020385 (Clk4)
Chromosomal location
Chr 11: 51076673 - 51095268 (+)
Description
CDC like kinase 4 Gene [Source:MGI (curated);Acc:Clk4-001]
RefSeq_dna
NM_007714 
RefSeq_peptide
NP_031740.1 
UniGene
Mm.471998 
MGI
MGI:1098551 
Uniprot/SWISSPROT
O35493 
Uniprot/SPTREMBL
B1ATD0 O35611 Q4FJV9 
Human Ortholog
ENSG00000113240 (CLK4)
Omim not available
UniTrap UNI29558
Vector Insertion
Chr 11: 51076772 - 51080672
Public Clones H002F03 (ggtc) IST12124E3HMR1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23310
Vector Insertion
Chr 11: 51080672 - 51080834
Public Clones not available
Private Clones OST265954 (lexicon) OST189243 (lexicon) OST135803 (lexicon) OST111804 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19255
Vector Insertion
Chr 11: 51084098 - 51085301
Public Clones IST11615E2 (tigm)
Private Clones OST398484 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30988
Vector Insertion
Chr 11: 51089750 - 51091354
Public Clones IST14548C4 (tigm) IST12748F2 (tigm) IST14827E7 (tigm) IST14676D6 (tigm)
IST13966E7 (tigm) IST11735G6 (tigm) IST10247C12 (tigm) IST14827G7 (tigm)
IST11735F6 (tigm) IST12828G8 (tigm) IST14805C6 (tigm) IST11709F11 (tigm)
IST11058H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109111
Sequence
GCTTTGCTAAAGATCATTTGGAAATATGCCACACTTAAGCATTCATTGTTTGAACAACTCGGTAATTGTGCTTAGGTACTTAGACCTCTCTTTCTCTCCC

TTACTTTAGATGAAATCGTGGACACTTTAGGTGAAGGAGCCTTTGGCAAAGTTGTAGAGTGCATTGATCACGGCAT GGATGGCTTACATGTAGCAGTGA

AAATTGTAAAAAATGTAGGCCGTTACCGGGAGGCAGCTCGTTCTGAAATCCAAGTATTGGAGCACTTGAACAGCACTGACCCCAACAGTGTCTT CCGAT

GCGTCCAGATGCTAGAGTGGTTTGATCATCATGGTCATGTTTGTATTGTGTTTGAGCTGCTGGGACTTAGTACCTATGATTTTATTAAAGAAAATAGTTT

TCTGCCATTTCAAATTGATCACATCAGGCAAATGGCTTATCAGATCTGCCAGTCTATAAATT TTTTACATCATAATAAATTAACACACACGGACCTAAA

ACCTGAAAATATTTTATTTGTGAAGTCTGACTATGTAGTCAAATACAATTCTAAAATG AAACGAGATGAGCGCACATTGAAAAACACAGATATCAAAGT

TGTTGATTTTGGAAGTGCAACATATGACGACGAACATCATAGTACTTTGGTGTCCACAAGGCACTACAGGGCTCCAGAGGTCATTTTGG - UNI30988

 - CTCTAGGTTGGTCTCAGCCTTGTGATGTTTGGAGCATAGGCTGCATTCTTATTGAGTACTACCTTGGGTTCACAGTCTTTCAG ACCCACGATAGTA

AAGAGCACCTGGCAATGATGGAGCGGATCTTAGGACCCATCCCAGCACATATGATCCAGAAGACAAG GAAACGCAAGTATTTCCACCATAACCAGCTAG

ATTGGGACGAGCATAGTTCAGCTGGGAGATATGTTAGGAGACGCTGCAAGCCGTTAAAG GAATTTATGCTGTGTCATGACGAAGAGCATGAGAAGCTGT

TTGACCTGGTTCGAAGAATGTTGGAGTATGACCCAGCGAGAAGGATCACCTTGGATGAAGCATTGCAGCACCCTTTCTTTGACTTATTAAAAAGGAAATG

AGTGGGAGTCAGGGGTCTTCTGTGTACTTCTCTAGGAGCAGTTACTTCCAGACTGTGTCAGTCAACTAAACCTTCTAATATTTTTGTAAACATTAAATTA

TTTTGTACAGTTAAGTGTAAATACTGTATGTTTTGTATCAATAGCATAACTACCTTGTTAAGTATGGTGTTGATAATGAATGCAATACAAGAGTTACAAT

GAATTTTCCTTTTGATGTTAATTGCCACTTTAAAGGCTTTTAGAATGCCCTTTGTGTCCAGTGATAAACGTGATTGGTCCCATCTTTTGTACATGAAGGT

TGACTCTGAAGTGATTTTTTTTTTTCCTCAAGTAAAAGGAAATCTTGA
Translation
M MDGLHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVF FRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINF

 FLHHNKLTHTDLKPENILFVKSDYVVKYNSKM KRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILA - UNI30988 - ALGWSQPC

DVWSIGCILIEYYLGFTVFQ THDSKEHLAMMERILGPIPAHMIQKTR RKRKYFHHNQLDWDEHSSAGRYVRRRCKPLK EFMLCHDEEHEKLFDLVRR

MLEYDPARRITLDEALQHPFFDLLKRK
Transcript ENSMUST00000109113
Sequence
GTCGGTGTCTGTCGCAGCGGCTGGAGAGGAACGACGGCGGTTTGGCGACATTTCTCGGCCAAAAGGCCGCTTGCTTTTGCGGAG - UNI19255 - - 

UNI23310 - - UNI29558 - TCACTATTTAGAAGCAAGATGCTTGAATGAGAGAGATTATCGGGACCGGAGATACATTGATGAATACAGAAATGAC

TACTGCGAAGGATATGTTCCAAGACATTACCATAGAGACGTTGAAAGCACTTACCGGATCCATTGCAGTAAATCCTCAGTCAGGAGCAGGAGAAGCAGCC

CTAAGAGAAAGCGTAATAGACCCTGTGCAAGTCATCAGTCGCATTCG ATGAAATCGTGGACACTTTAGGTGAAGGAGCCTTTGGCAAAGTTGTAGAGTG

CATTGATCACGGCAT GGATGGCTTACATGTAGCAGTGAAAATTGTAAAAAATGTAGGCCGTTACCGGGAGGCAGCTCGTTCTGAAATCCAAGTATTGGA

GCACTTGAACAGCACTGACCCCAACAGTGTCTT CCGATGCGTCCAGATGCTAGAGTGGTTTGATCATCATGGTCATGTTTGTATTGTGTTTGAGCTGCT

GGGACTTAGTACCTATGATTTTATTAAAGAAAATAGTTTTCTGCCATTTCAAATTGATCACATCAGGCAAATGGCTTATCAGATCTGCCAGTCTATAAAT

T TTTTACATCATAATAAATTAACACACACGGACCTAAAACCTGAAAATATTTTATTTGTGAAGTCTGACTATGTAGTCAAATACAATTCTAAAATG AA

ACGAGATGAGCGCACATTGAAAAACACAGATATCAAAGTTGTTGATTTTGGAAGTGCAACATATGACGACGAACATCATAGTACTTTGGTGTCCACAAGG

CACTACAGGGCTCCAGAGGTCATTTTGG - UNI30988 - CTCTAGGTTGGTCTCAGCCTTGTGATGTTTGGAGCATAGGCTGCATTCTTATTGAGTA

CTACCTTGGGTTCACAGTCTTTCAG ACCCACGATAGTAAAGAGCACCTGGCAATGATGGAGCGGATCTTAGGACCCATCCCAGCACATATGATCCAGAA

GACAAG GAAACGCAAGTATTTCCACCATAACCAGCTAGATTGGGACGAGCATAGTTCAGCTGGGAGATATGTTAGGAGACGCTGCAAGCCGTTAAAG G

AATTTATGCTGTGTCATGACGAAGAGCATGAGAAGCTGTTTGACCTGGTTCGAAGAATGTTGGAGTATGACCCAGCGAGAAGGATCACCTTGGATGAAGC

ATTGCAGCACCCTTTCTTTGACTTATTAAAAAGGAAATGAGTGGGAGTCAGGGGTCTTCTGTGTACTTCTCTAGGAGCAGTTACTTCCAGACTGTGTCAG

TCAACTAAACCTTCTAATATTTTTGTAAACATTAAATTATTTTGTACAGTTAAGTGTAAATACTGTATGTTTTGTATCAATAGCATAACTACCTTGTTAA

GTATGGTGTTGATAATGAATGCAATACAAGAGTTACAATGAATTTTCCTTTTGATGTTAATTGCCACTTTAAAGGCTTTTAGAATGCCCTTTGTGTCCAG

TGATAAACGTGATTGGTCCCATCTTTTGTACATGAAGGTTGACTCTGAAGTGATTTTTTTTTTTCCTCAAGTAAAAGGAAATCTTGACC
Translation
 - UNI19255 - - UNI23310 - - UNI29558 -  M MDGLHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVF FRCVQMLEWFDHHGHV

CIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINF FLHHNKLTHTDLKPENILFVKSDYVVKYNSKM KRDERTLKNTDIKVVDFGSATYDDE

HHSTLVSTRHYRAPEVILA - UNI30988 - ALGWSQPCDVWSIGCILIEYYLGFTVFQ THDSKEHLAMMERILGPIPAHMIQKTR RKRKYFHHNQ

LDWDEHSSAGRYVRRRCKPLK EFMLCHDEEHEKLFDLVRRMLEYDPARRITLDEALQHPFFDLLKRK
Transcript ENSMUST00000020652
Sequence
CGCGGACGCCATTTTGTCGGTGTCTGTCGCAGCGGCTGGAGAGGAACGACGGCGGTTTGGCGACATTTCTCGGCCAAAAGGCCGCTTGCTTTTGCGGAG 

- UNI23310 - - UNI29558 - ATGCGGCATTCCAAACGAACTCACTGTCCTGATTGGGATAGTAGAGAAAGCTGGGGCCATGAAAGCTACAGTGG

AAGTCACAAACGCAAGAGAAGGTCTCACAGCAGTACTCAGGAGAACAGGCACTGTAAACCACATCATCAGTTTAAAGACTCGGATTG - UNI23310 -

 ATGTTCCATTGGGGCTGTTTACCAGATTGCTTTCTAAATTAGCCAGCTGGGGTTACTTTAAAAAACA GGGTCTTTGTGTACAAATCTTTGCCTGTGGC

TATTTCCTGAGAGTAGATTCTAAGAAGAGGCATTTTCAAGTTAAAGG TGCTCCATGTGCATCCCTCTTGAAGCTTCGCACTCTGTTGAAGAGGACACTC

ATCCCAG - UNI19255 - TCACTATTTAGAAGCAAGATGCTTGAATGAGAGAGATTATCGGGACCGGAGATACATTGATGAATACAGAAATGACTAC

TGCGAAGGATATGTTCCAAGACATTACCATAGAGACGTTGAAAGCACTTACCGGATCCATTGCAGTAAATCCTCAGTCAGGAGCAGGAGAAGCAGCCCTA

AGAGAAAGCGTAATAGACCCTGTGCAAGTCATCAGTCGCATTCG AAGAGCCACCGAAGGAAAAGATCCAGGAGTATAGAGGATGATGAGGAGGGTCACC

TGATCTGTCAAAGTGGAGACGTTCTAAGAGCAAGAT ATGAAATCGTGGACACTTTAGGTGAAGGAGCCTTTGGCAAAGTTGTAGAGTGCATTGATCACG

GCAT GGATGGCTTACATGTAGCAGTGAAAATTGTAAAAAATGTAGGCCGTTACCGGGAGGCAGCTCGTTCTGAAATCCAAGTATTGGAGCACTTGAACA

GCACTGACCCCAACAGTGTCTT CCGATGCGTCCAGATGCTAGAGTGGTTTGATCATCATGGTCATGTTTGTATTGTGTTTGAGCTGCTGGGACTTAGTA

CCTATGATTTTATTAAAGAAAATAGTTTTCTGCCATTTCAAATTGATCACATCAGGCAAATGGCTTATCAGATCTGCCAGTCTATAAATT TTTTACATC

ATAATAAATTAACACACACGGACCTAAAACCTGAAAATATTTTATTTGTGAAGTCTGACTATGTAGTCAAATACAATTCTAAAATG AAACGAGATGAGC

GCACATTGAAAAACACAGATATCAAAGTTGTTGATTTTGGAAGTGCAACATATGACGACGAACATCATAGTACTTTGGTGTCCACAAGGCACTACAGGGC

TCCAGAGGTCATTTTGG - UNI30988 - CTCTAGGTTGGTCTCAGCCTTGTGATGTTTGGAGCATAGGCTGCATTCTTATTGAGTACTACCTTGGGT

TCACAGTCTTTCAG ACCCACGATAGTAAAGAGCACCTGGCAATGATGGAGCGGATCTTAGGACCCATCCCAGCACATATGATCCAGAAGACAAG GAAA

CGCAAGTATTTCCACCATAACCAGCTAGATTGGGACGAGCATAGTTCAGCTGGGAGATATGTTAGGAGACGCTGCAAGCCGTTAAAG GAATTTATGCTG

TGTCATGACGAAGAGCATGAGAAGCTGTTTGACCTGGTTCGAAGAATGTTGGAGTATGACCCAGCGAGAAGGATCACCTTGGATGAAGCATTGCAGCACC

CTTTCTTTGACTTATTAAAAAGGAAATGAGTGGGAGTCAGGGGTCTTCTGTGTACTTCTCTAGGAGCAGTTACTTCCAGACTGTGTCAGTCAACTAAACC

TTCTAATATTTTTGTAAACATTAAATTATTTTGTACAGTTAAGTGTAAATACTGTATGTTTTGTATCAATAGCATAACTACCTTGTTAAGTATGGTGTTG

ATAATGAATGCAATACAAGAGTTACAATGAATTTTCCTTTTGATGTTAATTGCCACTTTAAAGGCTTTTAGAATGCCCTTTGTGTCCAGTGATAAACGTG

ATTGGTCCCATCTTTTGTACATGAAGGTTGACTCTGAAGTGATTTTTTTTTTTCCTCAAGTAAAAGGAAATCTTG
Translation
 - UNI23310 - - UNI29558 - MKATVEVTNAREGLTAVLRRTGTVNHIISLKTRID - UNI23310 - DVPLGLFTRLLSKLASWGYFKKQ 

QGLCVQIFACGYFLRVDSKKRHFQVKG GAPCASLLKLRTLLKRTLIPV - UNI19255 - VTI       - UNI30988 -    
Transcript ENSMUST00000109114
Sequence
ATGCGGCATTCCAAACGAACTCACTGTCCTGATTGGGATAGTAGAGAAAGCTGGGGCCATGAAAGCTACAGTGGAAGTCACAAACGCAAGAGAAGGTCTC

ACAGCAGTACTCAGGAGAACAGGCACTGTAAACCACATCATCAGTTTAAAGACTCGGATTG - UNI19255 - - UNI23310 - TCACTATTTAGA

AGCAAGATGCTTGAATGAGAGAGATTATCGGGACCGGAGATACATTGATGAATACAGAAATGACTACTGCGAAGGATATGTTCCAAGACATTACCATAGA

GACGTTGAAAGCACTTACCGGATCCATTGCAGTAAATCCTCAGTCAGGAGCAGGAGAAGCAGCCCTAAGAGAAAGCGTAATAGACCCTGTGCAAGTCATC

AGTCGCATTCG ATGAAATCGTGGACACTTTAGGTGAAGGAGCCTTTGGCAAAGTTGTAGAGTGCATTGATCACGGCAT GGATGGCTTACATGTAGCAG

TGAAAATTGTAAAAAATGTAGGCCGTTACCGGGAGGCAGCTCGTTCTGAAATCCAAGTATTGGAGCACTTGAACAGCACTGACCCCAACAGTGTCTT CC

GATGCGTCCAGATGCTAGAGTGGTTTGATCATCATGGTCATGTTTGTATTGTGTTTGAGCTGCTGGGACTTAGTACCTATGATTTTATTAAAGAAAATAG

TTTTCTGCCATTTCAAATTGATCACATCAGGCAAATGGCTTATCAGATCTGCCAGTCTATAAATT TTTTACATCATAATAAATTAACACACACGGACCT

AAAACCTGAAAATATTTTATTTGTGAAGTCTGACTATGTAGTCAAATACAATTCTAAAATG AAACGAGATGAGCGCACATTGAAAAACACAGATATCAA

AGTTGTTGATTTTGGAAGTGCAACATATGACGACGAACATCATAGTACTTTGGTGTCCACAAGGCACTACAGGGCTCCAGAGGTCATTTTGG - UNI30

988 - CTCTAGGTTGGTCTCAGCCTTGTGATGTTTGGAGCATAGGCTGCATTCTTATTGAGTACTACCTTGGGTTCACAGTCTTTCAG ACCCACGATA

GTAAAGAGCACCTGGCAATGATGGAGCGGATCTTAGGACCCATCCCAGCACATATGATCCAGAAGACAAG GAAACGCAAGTATTTCCACCATAACCAGC

TAGATTGGGACGAGCATAGTTCAGCTGGGAGATATGTTAGGAGACGCTGCAAGCCGTTAAAG GAATTTATGCTGTGTCATGACGAAGAGCATGAGAAGC

TGTTTGACCTGGTTCGAAGAATGTTGGAGTATGACCCAGCGAGAAGGATCACCTTGGATGAAGCATTGCAGCACCCTTTCTTTGACTTATT
Translation
MRHSKRTHCPDWDSRESWGHESYSGSHKRKRRSHSSTQENRHCKPHHQFKDSDC - UNI19255 - - UNI23310 - CHYLEARCLNERDYRDRRY

IDEYRNDYCEGYVPRHYHRDVESTYRIHCSKSSVRSRRSSPKRKRNRPCASHQSHS MKSWTL     - UNI30988 -    
Transcript ENSMUST00000093132
Sequence
CGCGGACGCCATTTTGTCGGTGTCTGTCGCAGCGGCTGGAGAGGAACGACGGCGGTTTGGCGACATTTCTCGGCCAAAAGGCCGCTTGCTTTTGCGGAG 

- UNI23310 - - UNI29558 - ATGCGGCATTCCAAACGAACTCACTGTCCTGATTGGGATAGTAGAGAAAGCTGGGGCCATGAAAGCTACAGTGG

AAGTCACAAACGCAAGAGAAGGTCTCACAGCAGTACTCAGGAGAACAGGCACTGTAAACCACATCATCAGTTTAAAGACTCGGATTG - UNI19255 -

 - UNI23310 - TCACTATTTAGAAGCAAGATGCTTGAATGAGAGAGATTATCGGGACCGGAGATACATTGATGAATACAGAAATGACTACTGCGAAG

GATATGTTCCAAGACATTACCATAGAGACGTTGAAAGCACTTACCGGATCCATTGCAGTAAATCCTCAGTCAGGAGCAGGAGAAGCAGCCCTAAGAGAAA

GCGTAATAGACCCTGTGCAAGTCATCAGTCGCATTCG AAGAGCCACCGAAGGAAAAGATCCAGGAGTATAGAGGATGATGAGGAGGGTCACCTGATCTG

TCAAAGTGGAGACGTTCTAAGAGCAAGAT ATGAAATCGTGGACACTTTAGGTGAAGGAGCCTTTGGCAAAGTTGTAGAGTGCATTGATCACGGCAT GG

ATGGCTTACATGTAGCAGTGAAAATTGTAAAAAATGTAGGCCGTTACCGGGAGGCAGCTCGTTCTGAAATCCAAGTATTGGAGCACTTGAACAGCACTGA

CCCCAACAGTGTCTT CCGATGCGTCCAGATGCTAGAGTGGTTTGATCATCATGGTCATGTTTGTATTGTGTTTGAGCTGCTGGGACTTAGTACCTATGA

TTTTATTAAAGAAAATAGTTTTCTGCCATTTCAAATTGATCACATCAGGCAAATGGCTTATCAGATCTGCCAGTCTATAAATT TTTTACATCATAATAA

ATTAACACACACGGACCTAAAACCTGAAAATATTTTATTTGTGAAGTCTGACTATGTAGTCAAATACAATTCTAAAATG AAACGAGATGAGCGCACATT

GAAAAACACAGATATCAAAGTTGTTGATTTTGGAAGTGCAACATATGACGACGAACATCATAGTACTTTGGTGTCCACAAGGCACTACAGGGCTCCAGAG

GTCATTTTGG - UNI30988 - CTCTAGGTTGGTCTCAGCCTTGTGATGTTTGGAGCATAGGCTGCATTCTTATTGAGTACTACCTTGGGTTCACAGT

CTTTCAG ACCCACGATAGTAAAGAGCACCTGGCAATGATGGAGCGGATCTTAGGACCCATCCCAGCACATATGATCCAGAAGACAAG GAAACGCAAGT

ATTTCCACCATAACCAGCTAGATTGGGACGAGCATAGTTCAGCTGGGAGATATGTTAGGAGACGCTGCAAGCCGTTAAAG GAATTTATGCTGTGTCATG

ACGAAGAGCATGAGAAGCTGTTTGACCTGGTTCGAAGAATGTTGGAGTATGACCCAGCGAGAAGGATCACCTTGGATGAAGCATTGCAGCACCCTTTCTT

TGACTTATTAAAAAGGAAATGAGTGGGAGTCAGGGGTCTTCTGTGTACTTCTCTAGGAGCAGTTACTTCCAGACTGTGTCAGTCAACTAAACCTTCTAAT

ATTTTTGTAAACATTAAATTATTTTGTACAGTTAAGTGTAAATACTGTATGTTTTGTATCAATAGCATAACTACCTTGTTAAGTATGGTGTTGATAATGA

ATGCAATACAAGAGTTACAATGAATTTTCCTTTTGATGTTAATTGCCACTTTAAAGGCTTTTAGAATGCCCTTTGTGTCCAGTGATAAACGTGATTGGTC

CCATCTTTTGTACATGAAGGTTGACTCTGAAGTGATTTTTTTTTTTCCTCAAGTAAAAGGAAATCTTG
Translation
 - UNI23310 - - UNI29558 - MRHSKRTHCPDWDSRESWGHESYSGSHKRKRRSHSSTQENRHCKPHHQFKDSDC - UNI19255 - - UNI

23310 - CHYLEARCLNERDYRDRRYIDEYRNDYCEGYVPRHYHRDVESTYRIHCSKSSVRSRRSSPKRKRNRPCASHQSHS KSHRRKRSRSIEDDEE

GHLICQSGDVLRARY YEIVDTLGEGAFGKVVECIDHGM MDGLHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVF FRCVQMLEWFDHHGHVCIV

FELLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINF FLHHNKLTHTDLKPENILFVKSDYVVKYNSKM KRDERTLKNTDIKVVDFGSATYDDEHHS

TLVSTRHYRAPEVILA - UNI30988 - ALGWSQPCDVWSIGCILIEYYLGFTVFQ THDSKEHLAMMERILGPIPAHMIQKTR RKRKYFHHNQLDW

DEHSSAGRYVRRRCKPLK EFMLCHDEEHEKLFDLVRRMLEYDPARRITLDEALQHPFFDLLKRK

For any suggestions or comments, please send an email to unitrap@crg.es