Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020402 (Vdac1)
Chromosomal location
Chr 11: 52174362 - 52202899 (+)
Description
voltage-dependent anion channel 1 Gene [Source:MGI (curated);Acc:Vdac1-001]
RefSeq_dna
NM_011694 
RefSeq_peptide
NP_035824.1 
UniGene
Mm.3555 
MGI
MGI:106919 
Uniprot/SWISSPROT
Q60932 
Uniprot/SPTREMBL
Q3THL7 Q3TIG8 Q3U6K8 B1ASZ9 
Human Ortholog
ENSG00000213585 (VDAC1)
Omim 604492 - VOLTAGE-DEPENDENT ANION CHANNEL 1  
UniTrap UNI1557
Vector Insertion
Chr 11: 52174655 - 52187800
Public Clones CC0205 (sanger) P079D11 (ggtc) P016D07 (ggtc) P089D02 (ggtc) P096G01 (ggtc)
P015A12 (ggtc) P081D12 (ggtc) P078F08 (ggtc) P006F05 (ggtc) PST12863-NR (escells)
PST11299-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15257
Vector Insertion
Chr 11: 52174655 - 52187764
Public Clones (sanger) P139H11 (ggtc) P096G01 (ggtc) D145E04 (ggtc) D022A02 (ggtc)
P137D07 (ggtc) H003F04 (ggtc) D043G08 (ggtc) D004F02 (ggtc) P098B05 (ggtc)
E079H07 (ggtc) D022D06 (ggtc) P139A04 (ggtc) H010A03 (ggtc) D015G02 (ggtc)
P133H07 (ggtc) H003F03 (ggtc) D038C06 (ggtc) H010A02 (ggtc) P119A07 (ggtc)
H003E04 (ggtc) PST8641-NL (escells) PST18699-NR (escells) PST6590-NR (escells)
PST10048-NL (escells) IST12235C3 (tigm) IST14378E4 (tigm) IST11560B8 (tigm)
IST14123C2 (tigm) IST14286G8 (tigm) IST14979G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16414
Vector Insertion
Chr 11: 52187798 - 52187871
Public Clones not available
Private Clones OST461574 (lexicon) OST433456 (lexicon) OST422402 (lexicon) OST395548 (lexicon)
OST369594 (lexicon) OST367811 (lexicon) OST358027 (lexicon) OST337531 (lexicon)
OST334833 (lexicon) OST283974 (lexicon) OST274203 (lexicon) OST261875 (lexicon)
OST216920 (lexicon) OST206897 (lexicon) OST194169 (lexicon) OST178052 (lexicon)
OST151457 (lexicon) OST143718 (lexicon) OST132338 (lexicon) OST132242 (lexicon)
OST131131 (lexicon) OST125329 (lexicon) OST78376 (lexicon) OST68907 (lexicon)
OST53995 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21911
Vector Insertion
Chr 11: 52187871 - 52188419
Public Clones not available
Private Clones OST314346 (lexicon) OST289505 (lexicon) OST231009 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17103
Vector Insertion
Chr 11: 52190046 - 52190149
Public Clones not available
Private Clones OST449117 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30187
Vector Insertion
Chr 11: 52190203 - 52197351
Public Clones D086B06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2245
Vector Insertion
Chr 11: 52199236 - 52200917
Public Clones AL0250 (sanger) CMHD-GT_418H8-3 (cmhd) (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12633
Vector Insertion
Chr 11: 52200976 - 52201933
Public Clones (sanger) A023F03 (ggtc)
Private Clones OST469950 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102758
Sequence
CTATCGCCCCGTGCCAGAGTGCACGCAGGCCTTTACGCGCGGCCACACATGATCACAGAGCCGCAGAGGGCGAGAGCGCGGCTCGCGAGTGGGAAGAAGA

CCCCGAGACTGGTCTGGGCGCTGTCCGGGGTGGAGCCGAGGGCGGAGCTTCGGGGTCCGGCGCGCAGAGCTGGGGCGTGTCCGCGCCGCCGCGATCTGCG

CCGCTCCGCCCTCGGCCCGTTCGCTGCGCTCCCAGCCTCCTCGCCGCAACCCCCGCCGTAGCTGCCGCTGCTCCCGCCGTCACCGCCTCCGAG - UNI1

557 - - UNI15257 - - UNI16414 - AACATGGCCGTGCCTCCCACATACGCCGATCTTGGCAAGTCCGCCAGGGATGTCTTCACCAAGGGCTA

CG - UNI16414 - - UNI21911 - GCTTTGGCTTAATAAAACTTGATTTGAAAACGAAGTCAGAGAATGGATTG GAATTTACCAGCTCAGGCTC

TGCCAACACGGAAACCACCAAAGTGAACGGCAGCCTGGAAACCAAGTACAGATGGACTGAGTATGGGCTGACGTTTACAGAGAAGTGGAACACAGACAAC

ACCCTGGGCACTGAGATCACTGTGGAAGACCAG - UNI17103 - CTTGCTCGTGGACTGAAGCTCACCTTTGATTCGTCATTCTCGCCGAACACTGG

 - UNI30187 - GAAAAAAAATGCTAAAATCAAGACAGGGTACAAGAGGGAGCACATCAACCTCGGCTGTGACGTGGACTTTGACATCGCTGGGCCCT

CGATCCGGGGCGCTCTGGTGCTTGGCTATGAGGGTTGGCTGGCTGGCTACCAGATGAATTTTGAGACCTCGAAGTCCCGAGTGACCCAGAGCAACTTCGC

AGTTGGCTATAAGACGGATGAATTCCAGCTTCATACTAATGT GAATGACGGGACAGAGTTTGGTGGCTCCATTTACCAGAAGGTGAACAAGAAGTTGGA

GACTGCTGTCAATCTCGCCTGGACTGCAGGAAACAGTAACACTCGCTTCGGAATAGCAGCCAAGTATCAGGTCGACCCTGATGCCTGCTTTTCG - UNI

2245 - GCCAAAGTGAACAACTCTAGCCTGATTGGCTTAGGGTACACTCAGACCCTAAAACCAG - UNI12633 - GTATCAAACTGACGTTGTCAG

CCCTGCTCGATGGCAAGAACGTCAATGCGGGTGGCCACAAGCTTGGCCTAGGACTGGAATTTCAAGCATAAATGAATATTGTACAATCGTTTAATTTTAA

ACTATTTTGCAGCATAGCTACCTTCAGAATTTAGTGTACCTTTTAATGTTGTATGTTGGGGATGCGAGAGTTGATAAATACCACGTTAGACCTCCAGGCT

AAGGATGACTCGGCTTTAAGGTGTTTACCATTTCAGAGGTACAGCAGAAACCCCATTCCAGAAAGGGTCCTTTTTAGCTGTAGGCGTGGGTTGGGGAGGA

GCCCCTGTAGAGATGCCAGGCTACAAGTGGAAAGCTGGGAACATGTGGGTCCTTTGTAAATCTGTATCCAGTCCCCAGATGAAATTGTGACTTCCCGAGC

ATCGAACCCTGGTGTCCAGATCCTATCTGCTCGGAAGCATGTACACACCTGCGTGAAAGGGATGTTTTTAGACTGATCCTCACACCCTGTTCCCATCGTG

CCCTGTTCCCATCCTAGCCCATCACTTAACCTGTTTTACACCAAAAGTAGTCTTTAGGGTGTGGTTAGCTATTTCTTTTGTGCCATTTTAGGGTGGAGAG

GGTGGGCGTGATGGAGCCAGTCATTCAGGACTTAATTCTTCCTTGTGTTGTGGTGTGGTTTTCTTTCTTCTTCTTCTTTTTTTTTTTTAATTCCTTCTTT

CGCCATTGCACCAGAGTATGAAATAGCTTCCGGGTTCTCCGGCTCTGAGCTGGGCGGTGATTGTGGTCACACCCTGACAACACTAGGGATCTCAACTGAC

TCCTCTTGTAGCCTCACCACTATTTTTTAGCAGTTTAATGGGTACATTATAGAGTCTTCCATTTTGTGTGGAATTAGCTCCTCCCCTTCAAATGCTGTAA

TTAACATCACTTAAAATAAAACTTGAATAAAATACTGAAACCTCA
Translation
 - UNI1557 - - UNI15257 - - UNI16414 - MAVPPTYADLGKSARDVFTKGYG - UNI16414 - - UNI21911 - GFGLIKLDLKT

KSENGL EFTSSGSANTETTKVNGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQ - UNI17103 - LARGLKLTFDSSFSPNTG - UNI3018

7 - GKKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQLHTNV VNDGTEFGGSIYQKVNKK

LETAVNLAWTAGNSNTRFGIAAKYQVDPDACFS - UNI2245 - AKVNNSSLIGLGYTQTLKPG - UNI12633 - GIKLTLSALLDGKNVNAGGH

KLGLGLEFQA
Transcript ENSMUST00000109065
Sequence
AGAACATGGCCGTGCCTCCCACATACGCCGATCTTGGCAAGTCCGCCAGGGATGTCTTCACCAAGGGCTACG - UNI16414 - - UNI21911 - G

CTTTGGCTTAATAAAACTTGATTTGAAAACGAAGTCAGAGAATGGATTG GAATTTACCAGCTCAGGCTCTGCCAACACGGAAACCACCAAAGTGAACGG

CAGCCTGGAAACCAAGTACAGATGGACTGAGTATGGGCTGACGTTTACAGAGAAGTGGAACACAGACAACACCCTGGGCACTGAGATCACTGTGGAAGAC

CAG - UNI17103 - CTTGCTCGTGGACTGAAGCTCACCTTTGATTCGTCATTCTCGCCGAACACTGG - UNI30187 - GAAAAAAAATGCTAAA

ATCAAGACAGGGTACAAGAGGGAGCACATCAACCTCGGCTGTGACGTGGACTTTGACATCGCTGGGCCCTCGATCCGGGGCGCTCTGGTGCTTGGCTATG

AGGGTTGGCTGGCTGGCTACCAGATGAATTTTGAGACCTCGAAGTCCCGAGTGACCCAGAGCAACTTCGCAGTTGGCTATAAGACGGATGAATTCCAGCT

TCATACTAATGT GAATGACGGGACAGAGTTTGGTGGCTCCATTTACCAGAAGGTGAACAAGAAGTTGGAGACTGCTGTCAATCTCGCCTGGACTGCAGG

AAACAGTAACACTCGCTTCGGAATAGCAGCCAAGTATCAGGTCGACCCTGATGCCTGCTTTTCG - UNI2245 - GCCAAAGTGAACAACTCTAGCCT

GATTGGCTTAGGGTACACTCAGACCCTAAAACCAG - UNI12633 - GTATCAAACTGACGTTGTCAGCCCTGCTCGATGGCAAGAACGTCAATGCGG

GTGGCCACAAGCTTGGCCTAGGACTGGAATTTCAAGCATAAATGAATATTGTACAATCGTTTAATTTTAAACTATTTTGCAGCATAGCTACCTTCAGAAT

TTAGTGTACCTTTTAATGTTGTATGTTGGGGATGCGAGAGTTGATAAATACCACGTTAGACCTCCAGGCTAAGGATGACTCGGCTTTAAGGTGTTTACCA

TTTCAGAGGTACAGCAGAAACCCCATTCCAGAAAGGGTCCTTTTTAGCTGTAGGCGTGGGTTGGGGAGGAGCCCCTGTAGAGATGCCAGGCTACAAGTGG

AAAGCTGGGAACATGTGGGTCCTTTGTAAATCTGTATCCAGTCCCCAGATGAAATTGTGACTTCCCGAGCATCGAACCCTGGTGTCCAGATCCTATCTGC

TCGGAAGCATGTACACACCTGCGTGAAAGGGATGTTTTTAGACTGATCCTCACACCCTGTTCCCATCGTGCCCTGTTCCCATCCTAGCCCATCACTTAAC

CTGTTTTACACCAAAAGTAGTCTTTAGGGTGTGGTTAGCTATTTCTTTTGTGCCATTTTAGGGTGGAGAGGGTGGGCGTGATGGAGCCAGTCATTCAGGA

CTTAATTCTTCCTTGTGTTGTGGTGTGGTTTTCTTTCTTCTTCTTCTTTTTTTTTTTTAATTCCTTCTTTCGCCATTGCACCAGAGTATGAAATAGCTTC

CGGGTTCTCCGGCTCTGAGCTGGGCGGTGATTGTGGTCACACCCTGACAACACTAGGGATCTCAACTGACTCCTCTTGTAGCCTCACCACTATTTTTTAG

CAGTTTAATGGGTACATTATAGAGTCTTCCATTTTGTGTGGAATTAGCTCCTCCCCTTCAAATGCTGTAATTAACATCACTTAAAATAAAACTTGAATAA

AATACTGAAACCTC
Translation
MAVPPTYADLGKSARDVFTKGYG - UNI16414 - - UNI21911 - GFGLIKLDLKTKSENGL EFTSSGSANTETTKVNGSLETKYRWTEYGLTF

TEKWNTDNTLGTEITVEDQ - UNI17103 - LARGLKLTFDSSFSPNTG - UNI30187 - GKKNAKIKTGYKREHINLGCDVDFDIAGPSIRGAL

VLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQLHTNV VNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFS - UNI

2245 - AKVNNSSLIGLGYTQTLKPG - UNI12633 - GIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Transcript ENSMUST00000020673
Sequence
ATGTGTTCATTCTTTCTCGTGCTTTTGTTGTGGCAGAACATGGCCGTGCCTCCCACATACGCCGATCTTGGCAAGTCCGCCAGGGATGTCTTCACCAAGG

GCTACG - UNI16414 - - UNI21911 - GCTTTGGCTTAATAAAACTTGATTTGAAAACGAAGTCAGAGAATGGATTG GAATTTACCAGCTCAG

GCTCTGCCAACACGGAAACCACCAAAGTGAACGGCAGCCTGGAAACCAAGTACAGATGGACTGAGTATGGGCTGACGTTTACAGAGAAGTGGAACACAGA

CAACACCCTGGGCACTGAGATCACTGTGGAAGACCAG - UNI17103 - CTTGCTCGTGGACTGAAGCTCACCTTTGATTCGTCATTCTCGCCGAACA

CTGG - UNI30187 - GAAAAAAAATGCTAAAATCAAGACAGGGTACAAGAGGGAGCACATCAACCTCGGCTGTGACGTGGACTTTGACATCGCTGGG

CCCTCGATCCGGGGCGCTCTGGTGCTTGGCTATGAGGGTTGGCTGGCTGGCTACCAGATGAATTTTGAGACCTCGAAGTCCCGAGTGACCCAGAGCAACT

TCGCAGTTGGCTATAAGACGGATGAATTCCAGCTTCATACTAATGT GAATGACGGGACAGAGTTTGGTGGCTCCATTTACCAGAAGGTGAACAAGAAGT

TGGAGACTGCTGTCAATCTCGCCTGGACTGCAGGAAACAGTAACACTCGCTTCGGAATAGCAGCCAAGTATCAGGTCGACCCTGATGCCTGCTTTTCG -

 UNI2245 - GCCAAAGTGAACAACTCTAGCCTGATTGGCTTAGGGTACACTCAGACCCTAAAACCAG - UNI12633 - GTATCAAACTGACGTTG

TCAGCCCTGCTCGATGGCAAGAACGTCAATGCGGGTGGCCACAAGCTTGGCCTAGGACTGGAATTTCAAGCATAAATGAATATTGTACAATCGTTTAATT

TTAAACTATTTTGCAGCATAGCTACCTTCAGAATTTAGTGTACCTTTTAATGTTGTATGTTGGGGATGCGAGAGTTGATAAATACCACGTTAGACCTCCA

GGCTAAGGATGACTCGGCTTTAAGGTGTTTACCATTTCAGAGGTACAGCAGAAACCCCATTCCAGAAAGGGTCCTTTTTAGCTGTAGGCGTGGGTTGGGG

AGGAGCCCCTGTAGAGATGCCAGGCTACAAGTGGAAAGCTGGGAACATGTGGGTCCTTTGTAAATCTGTATCCAGTCCCCAGATGAAATTGTGACTTCCC

GAGCATCGAACCCTGGTGTCCAGATCCTATCTGCTCGGAAGCATGTACACACCTGCGTGAAAGGGATGTTTTTAGACTGATCCTCACACCCTGTTCCCAT

CGTGCCCTGTTCCCATCCTAGCCCATCACTTAACCTGTTTTACACCAAAAGTAGTCTTTAGGGTGTGGTTAGCTATTTCTTTTGTGCCATTTTAGGGTGG

AGAGGGTGGGCGTGATGGAGCCAGTCATTCAGGACTTAATTCTTCCTTGTGTTGTGGTGTGGTTTTCTTTCTTCTTCTTCTTTTTTTTTTTTAATTCCTT

CTTTCGCCATTGCACCAGAGTATGAAATAGCTTCCGGGTTCTCCGGCTCTGAGCTGGGCGGTGATTGTGGTCACACCCTGACAACACTAGGGATCTCAAC

TGACTCCTCTTGTAGCCTCACCACTATTTTTTAGCAGTTTAATGGGTACATTATAGAGTCTTCCATTTTGTGTGGAATTAGCTCCTCCCCTTCAAATGCT

GTAATTAACATCACTTAAAATAAAACTTGAATAAAATACTGAAACCTC
Translation
MCSFFLVLLLWQNMAVPPTYADLGKSARDVFTKGYG - UNI16414 - - UNI21911 - GFGLIKLDLKTKSENGL EFTSSGSANTETTKVNGSL

ETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQ - UNI17103 - LARGLKLTFDSSFSPNTG - UNI30187 - GKKNAKIKTGYKREHINLGCDV

DFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQLHTNV VNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQV

DPDACFS - UNI2245 - AKVNNSSLIGLGYTQTLKPG - UNI12633 - GIKLTLSALLDGKNVNAGGHKLGLGLEFQA

For any suggestions or comments, please send an email to unitrap@crg.es