Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020412 (Ascc2)
Chromosomal location
Chr 11: 4537766 - 4585307 (+)
Description
activating signal cointegrator 1 complex subunit 2 Gene [Source:MGI (curated);Acc:Ascc2-001]
RefSeq_dna
NM_029291 
RefSeq_peptide
NP_083567.1 
UniGene
Mm.439906 
MGI
MGI:1922702 
Uniprot/SWISSPROT
Q91WR3 
Uniprot/SPTREMBL
Q5NCK1 Q9CVZ2 Q3UG63 Q5NCK0 
Human Ortholog
ENSG00000100325 (ASCC2)
Omim not available
UniTrap UNI12218
Vector Insertion
Chr 11: 4537826 - 4540385
Public Clones W244D01 (ggtc) D145D06 (ggtc) P102B04 (ggtc) IST14623D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2631
Vector Insertion
Chr 11: 4540484 - 4546564
Public Clones XR0110 (sanger) XP0316 (sanger) XS0325 (sanger) E061A09 (ggtc)
(ggtc) IST12552F11 (tigm) IST14514E7 (tigm) IST11263H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24828
Vector Insertion
Chr 11: 4546724 - 4547065
Public Clones not available
Private Clones OST204657 (lexicon) OST195219 (lexicon) OST68547 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31878
Vector Insertion
Chr 11: 4547237 - 4549742
Public Clones IST13455D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37604
Vector Insertion
Chr 11: 4559388 - 4564231
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34843
Vector Insertion
Chr 11: 4573451 - 4579254
Public Clones IST11848C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109930
Sequence
CTGGATCTGTGGAAGCTGTGGTGTTTTGCAGCTGAACATCTCGGGTGTGGAGCCGGGGAG - UNI12218 - GAGGGTCACACAGCACAATGCCAGCT

CTGCCCCTGGACCAACTCCAGATCACCCACAAAGACCCGAAGACAGGACAGCCGAAGACTTCAGCAGCGCTG - UNI2631 - AACCCTGAGCAGAAG

GCAGACCGGTATTTTGTGTTGTACAAACCGCCCCCTAAAGACAACATTCCCGCCCTAGTGGAGGAGTACCTGGAACGTGCCAACTTCGTAGCTAATGACC

TCGACTGGCTCCTGGCCTTGCCTCACGATAAATTCTGGTGCCAG - UNI24828 - GTTATTTTTGATGAGACCCTGCAGAAGTGCCTGGACTCCTAC

CTGCACTATGTACCCCGAAAGTTTGATGAGTGGGTGGCCCCGACCCCTGAGGTGGCTGACATGCAGAATCACCTGCACCGGAGTGTTTTCCTCACCTTCC

TCCGAATGTCCACGCACAAGGAATCCAAA - UNI31878 - GACCACTTCATTTCTCCATCTGCATTTGGAGAAATCCTCTACAACAACTTCCTCTTT

GACATCCCGAAGATCCTGGACCTCTGTGTGCTCTTTGGAAAAGGCAACTCACCACTGCTCCAGAAAATGATAG GAAACATATTTACCCAGCAGCCAAGT

TACTATACTGACCTGGATGAAACCATTCCCACCATACTTCAG GTCTTCAGCAATATCCTCCAGCACTGTGGTTTGCAAGGGGATGGGACCAGCACCACA

CCCCAGAAACTCGGGGAGAGGAGTCCGTTGACCCCCAGTGACATGCCTCTCTTG GAATTAAAGGACATTGTTCTCTACCTGTGTGACACCTCCACCACA

CTCTGGGCCTTTCTGGACATCTTTCCTTTGGCCTGCCAAACCTTCCAGAAACATGACTTTTGTTACAG ACTAGCTTCCTTTTATGAGATGGCAATTCCG

GAATTGGAGTCTGCAATTAAGAAGAGGAGGCTTGAAGACAGCAA GCTCCTGGGTGACATGTGGCAGAGGCTCTCCCATTCCAAGAAGAAGCTAATGGAG

GTGTTTCACATCATCCTGAACCAGATCTGCCTGCTTCCCATTCTAGAGAGCAG CTGTGACAACATTCAAGGCTTCATTGAAGAATTCCTTCAAATCTTC

AGCTCTTTACTGCAGGAAAAAAG ATTCCTCCGTGACTACGACACATTCTCCCCTGTAGCTGAAGATATCAGCTTGCTGCAGCAAGCTTCATCAGCCTT 

GGATGAGACCCGGACTGCCTACATCCTCCAGGCTGTGGAAAGTGCCTGGGAAGGGGTTGACAGACAGAAAATCAAGGACATTAAAGACCCACCAAGGGCC

AAGGGTTCTAATAATGAAGTCACAGTGACAGCAGAGCCGGTCAGTGAGATGCCATCCCAGCTGGAGAACTTAGAAGAGGATGAGGAG TGCATGGGTGCA

GCAGCTGCGCTGGGCCCTGCCGTGAGTGGTGTGGAACTAGACTCACTCATCTCCCAAGTGAAGGACCTGCTGCCAGACCTCGGCGAGGGCTTTATTCTGG

CCTGCCTGGAGCACTACAGCTATGACTCAGAGCAGGTGATCAACAACATCCTGGAGGATCGGCTGGCCCCTGAGCTCAGTCAGCTGGACCGAGGCCTAGA

AAG GAAGGAGGAGAACGTGAGGAGCCTGGTGAATGACAAGCAGGCTGTGGTGGCACAGTGGCAGCGCTACCAGAAGTACAGCGTGGTGGTAGAGGAG G

TCCCCCTGCAGCCAGGAGAATACCAGGCTGATGACTATGAGGACGAGTATGACGACACATACGATGGCAACCAGGTGGGCGCCAACGATGCAGACTCTGA

TGACGAGCTCATCAGCCGCAG GCCCTTCACCATCCCTCAGGTGCTGAGAACCAAAATGCCTGGCGAAGTGCAGGAGGAGGAGTGGGATGAAGAGGATGA

GGTGGAAGAGGAGGCCCCCAAG CCAGACCATTTCATCCAGGATCCTGCAGTGCTGAGGGAAAAGGCTGAAGCCAGGCGCATGGCCTTCCTCGCCAGGAA

GGG GTATCGGCCTGAGAACTCCACGGCAGTAACAGGCGGCCCCCGGGGCCATGGGCAAAGCCGGGAAACAACCCAGGAACGCAGGAAGAAAGAAGCCAA

CAAGGCAGCCAGAGCCAACCACAACCGTAGAACCATGGCTGACCGAAAAAGAAGCAAAGGCATGATTCCATCCTGAGACCACAAGCTGCCTGGACGAGGG

ACGCCTTCAAGGCAGCTCTGCCCTCATGACCCTCAAGACCTACCAGCCAGCCGTGAGCGCCTTCTTGTCAAACACACAGTGCCTTATCCTTTGGTGGAGG

AACCCAGTGCCATCAAGCAGGCTGTCTCCCAGCTGTGCTGGCGGGAAAGGATGGGGATGCCGAACCAAAGTGTCTTTCATCTTGTGCAGCGAGGCACCAC

CTCCGGAAGTCCTGGATGGCAGGAGACCTGTATATTCAGAAGCAACGAAAGGCCCATGAATAAAGTTTCTGACCCTCCGGC
Translation
 - UNI12218 - MPALPLDQLQITHKDPKTGQPKTSAAL - UNI2631 - NPEQKADRYFVLYKPPPKDNIPALVEEYLERANFVANDLDWLLALP

HDKFWCQ - UNI24828 - VIFDETLQKCLDSYLHYVPRKFDEWVAPTPEVADMQNHLHRSVFLTFLRMSTHKESK - UNI31878 - DHFISPSA

FGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMIG GNIFTQQPSYYTDLDETIPTILQ VFSNILQHCGLQGDGTSTTPQKLGERSPLTPSDMPLL E

LKDIVLYLCDTSTTLWAFLDIFPLACQTFQKHDFCYR RLASFYEMAIPELESAIKKRRLEDSK KLLGDMWQRLSHSKKKLMEVFHIILNQICLLPILE

SS SCDNIQGFIEEFLQIFSSLLQEKR RFLRDYDTFSPVAEDISLLQQASSAL LDETRTAYILQAVESAWEGVDRQKIKDIKDPPRAKGSNNEVTVTA

EPVSEMPSQLENLEEDEE CMGAAAALGPAVSGVELDSLISQVKDLLPDLGEGFILACLEHYSYDSEQVINNILEDRLAPELSQLDRGLER RKEENVRS

LVNDKQAVVAQWQRYQKYSVVVEE VPLQPGEYQADDYEDEYDDTYDGNQVGANDADSDDELISRR RPFTIPQVLRTKMPGEVQEEEWDEEDEVEEEAP

K PDHFIQDPAVLREKAEARRMAFLARKG GYRPENSTAVTGGPRGHGQSRETTQERRKKEANKAARANHNRRTMADRKRSKGMIPS
Transcript ENSMUST00000070257
Sequence
CTGGATCTGTGGAAGCTGTGGTGTTTTGCAGCTGAACATCTCGGGTGTGGAGCCGGGGAG - UNI12218 - GAGGGTCACACAGCACAATGCCAGCT

CTGCCCCTGGACCAACTCCAGATCACCCACAAAGACCCGAAGACAGGACAGCCGAAGACTTCAGCAGCGCTG - UNI2631 - AACCCTGAGCAGAAG

GCAGACCGGTATTTTGTGTTGTACAAACCGCCCCCTAAAGACAACATTCCCGCCCTAGTGGAGGAGTACCTGGAACGTGCCAACTTCGTAGCTAATGACC

TCGACTGGCTCCTGGCCTTGCCTCACGATAAATTCTGGTGCCAG - UNI24828 - GTTATTTTTGATGAGACCCTGCAGAAGTGCCTGGACTCCTAC

CTGCACTATGTACCCCGAAAGTTTGATGAGTGGGTGGCCCCGACCCCTGAGGTGGCTGACATGCAGAATCACCTGCACCGGAGTGTTTTCCTCACCTTCC

TCCGAATGTCCACGCACAAGGAATCCAAA - UNI31878 - GACCACTTCATTTCTCCATCTGCATTTGGAGAAATCCTCTACAACAACTTCCTCTTT

GACATCCCGAAGATCCTGGACCTCTGTGTGCTCTTTGGAAAAGGCAACTCACCACTGCTCCAGAAAATGATAG GAAACATATTTACCCAGCAGCCAAGT

TACTATACTGACCTGGATGAAACCATTCCCACCATACTTCAG GTCTTCAGCAATATCCTCCAGCACTGTGGTTTGCAAGGGGATGGGACCAGCACCACA

CCCCAGAAACTCGGGGAGAGGAGTCCGTTGACCCCCAGTGACATGCCTCTCTTG GAATTAAAGGACATTGTTCTCTACCTGTGTGACACCTCCACCACA

CTCTGGGCCTTTCTGGACATCTTTCCTTTGGCCTGCCAAACCTTCCAGAAACATGACTTTTGTTACAG ACTAGCTTCCTTTTATGAGATGGCAATTCCG

GAATTGGAGTCTGCAATTAAGAAGAGGAGGCTTGAAGACAGCAA GCTCCTGGGTGACATGTGGCAGAGGCTCTCCCATTCCAAGAAGAAGCTAATGGAG

GTGTTTCACATCATCCTGAACCAGATCTGCCTGCTTCCCATTCTAGAGAGCAG CTGTGACAACATTCAAGGCTTCATTGAAGAATTCCTTCAAATCTTC

AGCTCTTTACTGCAGGAAAAAAG ATTCCTCCGTGACTACGACACATTCTCCCCTGTAGCTGAAGATATCAGCTTGCTGCAGCAAGCTTCATCAGCCTT 

GGATGAGACCCGGACTGCCTACATCCTCCAGGCTGTGGAAAGTGCCTGGGAAGGGGTTGACAGACAGAAAATCAAGGACATTAAAGACCCACCAAGGGCC

AAGGGTTCTAATAATGAAGTCACAGTGACAGCAGAGCCGGTCAGTGAGATGCCATCCCAGCTGGAGAACTTAGAAGAGGATGAGGAG TGCATGGGTGCA

GCAGCTGCGCTGGGCCCTGCCGTGAGTGGTGTGGAACTAGACTCACTCATCTCCCAAGTGAAGGACCTGCTGCCAGACCTCGGCGAGGGCTTTATTCTGG

CCTGCCTGGAGCACTACAGCTATGACTCAGAGCAGGTGATCAACAACATCCTGGAGGATCGGCTGGCCCCTGAGCTCAGTCAGCTGGACCGAGGCCTAGA

AAG ACAAGTGAAGCCGGACCCTACACCCCTGTTGTCATCTCGTCACAACATCTTCCAGAACGATGAGTTTGATGTGTTCAGCAGGGACTCGGTGGACCT

GAGCCGAGTGCACAAGGGCAGGAG GAAGGAGGAGAACGTGAGGAGCCTGGTGAATGACAAGCAGGCTGTGGTGGCACAGTGGCAGCGCTACCAGAAGTA

CAGCGTGGTGGTAGAGGAG GTCCCCCTGCAGCCAGGAGAATACCAGGCTGATGACTATGAGGACGAGTATGACGACACATACGATGGCAACCAGGTGGG

CGCCAACGATGCAGACTCTGATGACGAGCTCATCAGCCGCAG GCCCTTCACCATCCCTCAGGTGCTGAGAACCAAAATGCCTGGCGAAGTGCAGGAGGA

GGAGTGGGATGAAGAGGATGAGGTGGAAGAGGAGGCCCCCAAG CCAGACCATTTCATCCAGGATCCTGCAGTGCTGAGGGAAAAGGCTGAAGCCAGGCG

CATGGCCTTCCTCGCCAGGAAGGG GTATCGGCCTGAGAACTCCACGGCAGTAACAGGCGGCCCCCGGGGCCATGGGCAAAGCCGGGAAACAACCCAGGA

ACGCAGGAAGAAAGAAGCCAACAAGGCAGCCAGAGCCAACCACAACCGTAGAACCATGGCTGACCGAAAAAGAAGCAAAGGCATGATTCCATCCTGAGAC

CACAAGCTGCCTGGACGAGGGACGCCTTCAAGGCAGCTCTGCCCTCATGACCCTCAAGACCTACCAGCCAGCCGTGAGCGCCTTCTTGTCAAACACACAG

TGCCTTATCCTTTGGTGGAGGAACCCAGTGCCATCAAGCAGGCTGTCTCCCAGCTGTGCTGGCGGGAAAGGATGGGGATGCCGAACCAAAGTGTCTTTCA

TCTTGTGCAGCGAGGCACCACCTCCGGAAGTCCTGGATGGCAGGAGACCTGTATATTCAGAAGCAACGAAAGGCCCATGAATAAAGTTTCTGACCCTCCG

GC
Translation
 - UNI12218 - MPALPLDQLQITHKDPKTGQPKTSAAL - UNI2631 - NPEQKADRYFVLYKPPPKDNIPALVEEYLERANFVANDLDWLLALP

HDKFWCQ - UNI24828 - VIFDETLQKCLDSYLHYVPRKFDEWVAPTPEVADMQNHLHRSVFLTFLRMSTHKESK - UNI31878 - DHFISPSA

FGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMIG GNIFTQQPSYYTDLDETIPTILQ VFSNILQHCGLQGDGTSTTPQKLGERSPLTPSDMPLL E

LKDIVLYLCDTSTTLWAFLDIFPLACQTFQKHDFCYR RLASFYEMAIPELESAIKKRRLEDSK KLLGDMWQRLSHSKKKLMEVFHIILNQICLLPILE

SS SCDNIQGFIEEFLQIFSSLLQEKR RFLRDYDTFSPVAEDISLLQQASSAL LDETRTAYILQAVESAWEGVDRQKIKDIKDPPRAKGSNNEVTVTA

EPVSEMPSQLENLEEDEE CMGAAAALGPAVSGVELDSLISQVKDLLPDLGEGFILACLEHYSYDSEQVINNILEDRLAPELSQLDRGLER RQVKPDPT

PLLSSRHNIFQNDEFDVFSRDSVDLSRVHKGRR RKEENVRSLVNDKQAVVAQWQRYQKYSVVVEE VPLQPGEYQADDYEDEYDDTYDGNQVGANDADS

DDELISRR RPFTIPQVLRTKMPGEVQEEEWDEEDEVEEEAPK PDHFIQDPAVLREKAEARRMAFLARKG GYRPENSTAVTGGPRGHGQSRETTQERR

KKEANKAARANHNRRTMADRKRSKGMIPS
Transcript ENSMUST00000109932
Sequence
CTGGATCTGTGGAAGCTGTGGTGTTTTGCAGCTGAACATCTCGGGTGTGGAGCCGGGGAG - UNI12218 - GAGGGTCACACAGCACAATGCCAGCT

CTGCCCCTGGACCAACTCCAGATCACCCACAAAGACCCGAAGACAGGACAGCCGAAGACTTCAGCAGCGCTG - UNI2631 - AACCCTGAGCAGAAG

GCAGACCGGTATTTTGTGTTGTACAAACCGCCCCCTAAAGACAACATTCCCGCCCTAGTGGAGGAGTACCTGGAACGTGCCAACTTCGTAGCTAATGACC

TCGACTGGCTCCTGGCCTTGCCTCACGATAAATTCTGGTGCCAG - UNI24828 - GTTATTTTTGATGAGACCCTGCAGAAGTGCCTGGACTCCTAC

CTGCACTATGTACCCCGAAAGTTTGATGAGTGGGTGGCCCCGACCCCTGAGGTGGCTGACATGCAGAATCACCTGCACCGGAGTGTTTTCCTCACCTTCC

TCCGAATGTCCACGCACAAGGAATCCAAA - UNI31878 - GACCACTTCATTTCTCCATCTGCATTTGGAGAAATCCTCTACAACAACTTCCTCTTT

GACATCCCGAAGATCCTGGACCTCTGTGTGCTCTTTGGAAAAGGCAACTCACCACTGCTCCAGAAAATGATAG GAAACATATTTACCCAGCAGCCAAGT

TACTATACTGACCTGGATGAAACCATTCCCACCATACTTCAG GTCTTCAGCAATATCCTCCAGCACTGTGGTTTGCAAGGGGATGGGACCAGCACCACA

CCCCAGAAACTCGGGGAGAGGAGTCCGTTGACCCCCAGTGACATGCCTCTCTTG GAATTAAAGGACATTGTTCTCTACCTGTGTGACACCTCCACCACA

CTCTGGGCCTTTCTGGACATCTTTCCTTTGGCCTGCCAAACCTTCCAGAAACATGACTTTTGTTACAG ACTAGCTTCCTTTTATGAGATGGCAATTCCG

GAATTGGAGTCTGCAATTAAGAAGAGGAGGCTTGAAGACAGCAA GCTCCTGGGTGACATGTGGCAGAGGCTCTCCCATTCCAAGAAGAAGCTAATGGAG

GTGTTTCACATCATCCTGAACCAGATCTGCCTGCTTCCCATTCTAGAGAGCAG CTGTGACAACATTCAAGGCTTCATTGAAGAATTCCTTCAAATCTTC

AGCTCTTTACTGCAGGAAAAAAG ATTCCTCCGTGACTACGACACATTCTCCCCTGTAGCTGAAGATATCAGCTTGCTGCAGCAAGCTTCATCAGCCTT 

GGATGAGACCCGGACTGCCTACATCCTCCAGGCTGTGGAAAGTGCCTGGGAAGGGGTTGACAGACAGAAAATCAAGGACATTAAAGACCCACCAAGGGCC

AAGGGTTCTAATAATGAAGTCACAGTGACAGCAGAGCCGGTCAGTGAGATGCCATCCCAGCTGGAGAACTTAGAAGAGGATGAGGAG TGCATGGGTGCA

GCAGCTGCGCTGGGCCCTGCCGTGAGTGGTGTGGAACTAGACTCACTCATCTCCCAAGTGAAGGACCTGCTGCCAGACCTCGGCGAGGGCTTTATTCTGG

CCTGCCTGGAGCACTACAGCTATGACTCAGAGCAGGTGATCAACAACATCCTGGAGGATCGGCTGGCCCCTGAGCTCAGTCAGCTGGACCGAGGCCTAGA

AAG ACAAGTGAAGCCGGACCCTACACCCCTGTTGTCATCTCGTCACAACATCTTCCAGAACGATGAGTTTGATGTGTTCAGCAGGGACTCGGTGGACCT

GAGCCGAGTGCACAAGGGCAGGAG GAAGGAGGAGAACGTGAGGAGCCTGGTGAATGACAAGCAGGCTGTGGTGGCACAGTGGCAGCGCTACCAGAAGTA

CAGCGTGGTGGTAGAGGAG GTCCCCCTGCAGCCAGGAGAATACCAGGCTGATGACTATGAGGACGAGTATGACGACACATACGATGGCAACCAGGTGGG

CGCCAACGATGCAGACTCTGATGACGAGCTCATCAGCCGCAG GCCCTTCACCATCCCTCAGGTGCTGAGAACCAAAATGCCTGGCGAAGTGCAGGAGGA

GGAGTGGGATGAAGAGGATGAGGTGGAAGAGGAGGCCCCCAAG CCAGACCATTTCATCCAGGATCCTGCAGTGCTGAGGGAAAAGGCTGAAGCCAGGCG

CATGGCCTTCCTCGCCAGGAAGGG GTATCGGCCTGAGAACTCCACGGCAGTAACAGGCGGCCCCCGGGGCCATGGGCAAAGCCGGGAAACAACCCAGGA

ACGCAGGAAGAAAGAAGCCAACAAGGCAGCCAGAGCCAA CCACAAGAGCTTTTGTGCCCCAGAGATGGATTATGAGAGACCCGAGGGCCTGCGGAGAGG

AGCAGAGCTGGCAGTCTGCCCATGGTGTCTTAGTAGTGGGTGCGTGTGTCCTTGTTAA
Translation
 - UNI12218 - MPALPLDQLQITHKDPKTGQPKTSAAL - UNI2631 - NPEQKADRYFVLYKPPPKDNIPALVEEYLERANFVANDLDWLLALP

HDKFWCQ - UNI24828 - VIFDETLQKCLDSYLHYVPRKFDEWVAPTPEVADMQNHLHRSVFLTFLRMSTHKESK - UNI31878 - DHFISPSA

FGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMIG GNIFTQQPSYYTDLDETIPTILQ VFSNILQHCGLQGDGTSTTPQKLGERSPLTPSDMPLL E

LKDIVLYLCDTSTTLWAFLDIFPLACQTFQKHDFCYR RLASFYEMAIPELESAIKKRRLEDSK KLLGDMWQRLSHSKKKLMEVFHIILNQICLLPILE

SS SCDNIQGFIEEFLQIFSSLLQEKR RFLRDYDTFSPVAEDISLLQQASSAL LDETRTAYILQAVESAWEGVDRQKIKDIKDPPRAKGSNNEVTVTA

EPVSEMPSQLENLEEDEE CMGAAAALGPAVSGVELDSLISQVKDLLPDLGEGFILACLEHYSYDSEQVINNILEDRLAPELSQLDRGLER RQVKPDPT

PLLSSRHNIFQNDEFDVFSRDSVDLSRVHKGRR RKEENVRSLVNDKQAVVAQWQRYQKYSVVVEE VPLQPGEYQADDYEDEYDDTYDGNQVGANDADS

DDELISRR RPFTIPQVLRTKMPGEVQEEEWDEEDEVEEEAPK PDHFIQDPAVLREKAEARRMAFLARKG GYRPENSTAVTGGPRGHGQSRETTQERR

KKEANKAARAN NHKSFCAPEMDYERPEGLRRGAELAVCPWCLSSGCVCPC

For any suggestions or comments, please send an email to unitrap@crg.es