Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020415 (Pttg1)
Chromosomal location
Chr 11: 43233766 - 43239753 (-)
Description
pituitary tumor-transforming 1 Gene [Source:MGI (curated);Acc:Pttg1-001]
RefSeq_dna
NM_013917 
RefSeq_peptide
NP_038945.2 NP_001124526.1 
UniGene
Mm.6856 Mm.473416 
MGI
MGI:1353578 
Uniprot/SWISSPROT
Q9CQJ7 
Uniprot/SPTREMBL
B0QZU0 B0QZU1 Q3Y5K4 Q5SRU0 
Human Ortholog
ENSG00000213005 (PTTG3)
Omim not available
UniTrap UNI25394
Vector Insertion
Chr 11: 43239084 - 43239184
Public Clones not available
Private Clones OST185475 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38350
Vector Insertion
Chr 11: 43239084 - 43239705
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21768
Vector Insertion
Chr 11: 43236489 - 43238220
Public Clones not available
Private Clones OST318540 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117446
Sequence
TCTTGAACTTGTTATGTAGCAGGAGGCCAAATTTGAGCATCCTCTTGGCTTCTCTTTATAGCAGAGATTGTAGGCTGGAGACAGTTTTGATGGGTGCCAA

CATAAACTGATTTCTGTAAGAGTTGAGTGTTTTATGACCCTGGCGTGCAGATTTAGGATCTGGATTAAGCCTGTTGACTTCTCCAGCTACTTATAAATTT

TTGTGCATAGGTGCCCTGGGTAAAGCTTGGTCTCTGTTACTGCGTAGTTTTTCCAGCCGTCCTCAATGCCAATATCCTAATATTCAGGTCTCTCCCTTAG

AGTAATCCAGAATGGCTACTCTTATCTTTGTTGATAAGGATAATGAAGAACCCGGCCGCCGTTTGGCATCTAAGGATGGGTTGAAGCTGGGCACTGGTG 

- UNI25394 - TCAAGGCCTTAGATGGGAAATTGCAGGTTTCAACGCCTCGAGTCGGCAAAGTGTTCAATGCTCCAGCCGTGCCTAAAGCCAGCAGAA

AGGCTTTGGGGACAGTCAACAGAGTTGCCGAAAAGCCTATGAAGACTGGCAAACCCCTCCAACCAAAACAGCCGACCTTGACTGGGAAAAAG - UNI21

768 - ATCACCGAGAAGTCTACTAAGACACAAAGTTCTGTTCCTGCTCCTGATGATGCCTACCCAGAAATAGAAAAGTTCTTCCCTTTCAATCCTCTAG

 ACTTTGAGAGTTTTGACCTGCCTGAGGAGCACCAGATCTCACTTCTCCCCTTGAATGGCGTGCCTCTCATGACCCTGAATGAAGAGAGAGGGCTGGAGA

AGCTGCTGCATCTGGGCCCCCCTAGCCCTCTGAAGACACCCTTTCTATCATGGGAATCTGGTAAGGGAGTCCGTTCAAACTCGGGCTGTAAGCAACTTGT

CACATGACACGTTTTTGTTGTCGGGACTGAATTGTACAGGTGAGTCTCTGGGCAGCTTCGGGATATTGGGGCCAAGTTTAGAATAAGAACTTCCCTCAGT

CATTGTGTATGGTTGAGTCCCAAAAGAAGGTTTTCTGGAACCTTGGCCAGCCTTTGGTGATAGCAGTGGGTGAAGTTGAACACAGAGCTGCTTAGGCTAG

GAGTTGAAGTCTGTGGTAACTGAGACTGGATGAGCACTCCAGGTTCCACCTGTGGCTGTCAGAGGACCAGTGTAGACTGACAGTAACTTGTCAACCACTG

AAAGCTTAAGGCTTTAGTTAGAACGGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGAGGGAGAGAGAGAGAGAGAGAGAGAGAAAGTGCCTCA

AATGAGATGGGTTGCCGGTCTGATTTTATGATTTTGTGAGACTTTATGCTCAAGAGAACAAGTAGCTTTCGCGTATTTTAAAGACCTGCTTCTTGACTAC

CCACACTGATGCCGACACTGATGCTACATGTAAAAGATCTGCATGTGTGCGTGAGATTCATTAGATGAATGTAGGATGAAAGTTAGCAGCTAATGTTTGT

TATGGATGATGGCTAGAAAGGAAGTGCAGAATCTAACGAGAAACTCCTCTTCTTCCAGATCCGCTGTACTCTCCTCCCAGTGCCCTCTCCACTCTGGATG

TTGAATTGCCGCCTGTTTGTTACGATGCAGATATTTAAACTTCTTACTTCTTTGTAGTTTCTGTATGTATGTTGTATTAATAAAGCATTTGTGCATATGT

TCA
Translation
MATLIFVDKDNEEPGRRLASKDGLKLGTGV - UNI25394 - VKALDGKLQVSTPRVGKVFNAPAVPKASRKALGTVNRVAEKPMKTGKPLQPKQPTL

TGKK - UNI21768 - ITEKSTKTQSSVPAPDDAYPEIEKFFPFNPLD DFESFDLPEEHQISLLPLNGVPLMTLNEERGLEKLLHLGPPSPLKTPFL

SWESGKGVRSNSGCKQLVT
Transcript ENSMUST00000020685
Sequence
GAGTTACAGTTTAAACTGCGGTGTGCCGGGTCGTTGGTGGCGCAGTCTTCG - UNI25394 - AGTAATCCAGAATGGCTACTCTTATCTTTGTTGAT

AAGGATAATGAAGAACCCGGCCGCCGTTTGGCATCTAAGGATGGGTTGAAGCTGGGCACTGGTG - UNI25394 - TCAAGGCCTTAGATGGGAAATT

GCAGGTTTCAACGCCTCGAGTCGGCAAAGTGTTCAATGCTCCAGCCGTGCCTAAAGCCAGCAGAAAGGCTTTGGGGACAGTCAACAGAGTTGCCGAAAAG

CCTATGAAGACTGGCAAACCCCTCCAACCAAAACAGCCGACCTTGACTGGGAAAAAG - UNI21768 - ATCACCGAGAAGTCTACTAAGACACAAAG

TTCTGTTCCTGCTCCTGATGATGCCTACCCAGAAATAGAAAAGTTCTTCCCTTTCAATCCTCTAG ACTTTGAGAGTTTTGACCTGCCTGAGGAGCACCA

GATCTCACTTCTCCCCTTGAATGGCGTGCCTCTCATGACCCTGAATGAAGAGAGAGGGCTGGAGAAGCTGCTGCATCTGGGCCCCCCTAGCCCTCTGAAG

ACACCCTTTCTATCATGGGAATCTGGTAAGGGAGTCCGTTCAAACTCGGGCTGTAAGCAACTTGTCACATGA
Translation
 - UNI25394 - MATLIFVDKDNEEPGRRLASKDGLKLGTGV - UNI25394 - VKALDGKLQVSTPRVGKVFNAPAVPKASRKALGTVNRVAEKP

MKTGKPLQPKQPTLTGKK - UNI21768 - ITEKSTKTQSSVPAPDDAYPEIEKFFPFNPLD DFESFDLPEEHQISLLPLNGVPLMTLNEERGLEKL

LHLGPPSPLKTPFLSWESGKGVRSNSGCKQLVT
Transcript ENSMUST00000121638
Sequence
GCAGGAGGCCAAATTTGAGCATCCTCTTGGCTTCTCTTTATAGCAGAGATTGTAGGCTGGAGACAGTTTTGATGGGTGCCAACATAAACTGATTTCTGTA

AGAGTTGAGTGTTTTATGACCCTGGCGTGCAGATTTAGGATCTGGATTAAGCCTGTTGACTTCTCCAGCTACTTATAAATTTTTGTGCATAGGTGCCCTG

GGTAAAGCTTGGTCTCTGTTACTGCGTAGTTTTTCCAGCCGTCCTCAATGCCAATATCCTAATATTCAGGTCTCTCCCTTAGAGTAATCCAGAATGGCTA

CTCTTATCTTTGTTGATAAGGATAATGAAGAACCCGGCCGCCGTTTGGCATCTAAGGATGGGTTGAAGCTGGGCACTGGTG - UNI25394 - TCAAG

GCCTTAGATGGGAAATTGCAGGTTTCAACGCCTCGAGTCGGCAAAGTGTTCAATGCTCCAGCCGTGCCTAAAGCCAGCAGAAAGGCTTTGGGGACAGTCA

ACAGAGTTGCCGAAAAGCCTATGAAGACTGGCAAACCCCTCCAACCAAAACAGCCGACCTTGACTGGGAAAAAG - UNI21768 - ATCACCGAGAAG

TCTACTAAGACACAAAGTTCTGTTCCTGCTCCTGATGATGCCTACCCAGAAATAGAAAAGTTCTTCCCTTTCAATCCTCTAG ACTTTGAGAGTTTTGAC

CTGCCTGAGGAGCACCAGATCTCACTTCTCCCCTTGAATGGCGTGCCTCTCATGACCCTGAATGAAGAGAGAGGGCTGGAGAAGCTGCTGCATCTGGGCC

CCCCTAGCCCTCTGAAGACACCCTTTCTATCATGGGAATCTG ATCCGCTGTACTCTCCTCCCAGTGCCCTCTCCACTCTGGATGTTGAATTGCCGCCTG

TTTGTTACGATGCAGATATTTAAACTTCTTACTTCTTTGTAGTTTCTGTATGTATGTTGTATTAATAAAGCATTTGTG
Translation
MATLIFVDKDNEEPGRRLASKDGLKLGTGV - UNI25394 - VKALDGKLQVSTPRVGKVFNAPAVPKASRKALGTVNRVAEKPMKTGKPLQPKQPTL

TGKK - UNI21768 - ITEKSTKTQSSVPAPDDAYPEIEKFFPFNPLD DFESFDLPEEHQISLLPLNGVPLMTLNEERGLEKLLHLGPPSPLKTPFL

SWESD DPLYSPPSALSTLDVELPPVCYDADI
Transcript ENSMUST00000101340
Sequence
CGGTGAGTTTAGCTGTGAGCTCGTCGTGG - UNI25394 - AGTAATCCAGAATGGCTACTCTTATCTTTGTTGATAAGGATAATGAAGAACCCGGCC

GCCGTTTGGCATCTAAGGATGGGTTGAAGCTGGGCACTGGTG - UNI25394 - TCAAGGCCTTAGATGGGAAATTGCAGGTTTCAACGCCTCGAGTC

GGCAAAGTGTTCAATGCTCCAGCCGTGCCTAAAGCCAGCAGAAAGGCTTTGGGGACAGTCAACAGAGTTGCCGAAAAGCCTATGAAGACTGGCAAACCCC

TCCAACCAAAACAGCCGACCTTGACTGGGAAAAAG - UNI21768 - ATCACCGAGAAGTCTACTAAGACACAAAGTTCTGTTCCTGCTCCTGATGAT

GCCTACCCAGAAATAGAAAAGTTCTTCCCTTTCAATCCTCTAG ACTTTGAGAGTTTTGACCTGCCTGAGGAGCACCAGATCTCACTTCTCCCCTTGAAT

GGCGTGCCTCTCATGACCCTGAATGAAGAGAGAGGGCTGGAGAAGCTGCTGCATCTGGGCCCCCCTAGCCCTCTGAAGACACCCTTTCTATCATGGGAAT

CTG ATCCGCTGTACTCTCCTCCCAGTGCCCTCTCCACTCTGGATGTTGAATTGCCGCCTGTTTGTTACGATGCAGATATTTAAACTTCTTACTTCTTTG

TAGTTTCTGTATGTATGTTGTATTAATAAAGCATTTGTGCATAT
Translation
 - UNI25394 - MATLIFVDKDNEEPGRRLASKDGLKLGTGV - UNI25394 - VKALDGKLQVSTPRVGKVFNAPAVPKASRKALGTVNRVAEKP

MKTGKPLQPKQPTLTGKK - UNI21768 - ITEKSTKTQSSVPAPDDAYPEIEKFFPFNPLD DFESFDLPEEHQISLLPLNGVPLMTLNEERGLEKL

LHLGPPSPLKTPFLSWESD DPLYSPPSALSTLDVELPPVCYDADI
Transcript ENSMUST00000118368
Sequence
TGGTGGCGCAGTCTTCGGTGAGTTTAGCT - UNI25394 - AGTAATCCAGAATGGCTACTCTTATCTTTGTTGATAAGGATAATGAAGAACCCGGCC

GCCGTTTGGCATCTAAGGATGGGTTGAAGCTGGGCACTGGTG - UNI25394 - TCAAGGCCTTAGATGGGAAATTGCAGGTTTCAACGCCTCGAGTC

GGCAAAGTGTTCAATGCTCCAGCCGTGCCTAAAGCCAGCAGAAAGGCTTTGGGGACAGTCAACAGAGTTGCCGAAAAGCCTATGAAGACTGGCAAACCCC

TCCAACCAAAACAGCCGACCTTGACTGGGAAAAAG - UNI21768 - ATCACCGAGAAGTCTACTAAGACACAAAGTTCTGTTCCTGCTCCTGATGAT

GCCTACCCAGAAATAGAAAAGTTCTTCCCTTTCAATCCTCTAG ACTTTGAGAGTTTTGACCTGCCTGAGGAGCACCAGATCTCACTTCTCCCCTTGAAT

GGCGTGCCTCTCATGACCCTGAATGAAGAGAGAGGGCTGGAGAAGCTGCTGCATCTGGGCCCCCCTAGCCCTCTGAAGACACCCTTTCTATCATGGGAAT

CTG ATCCGCTGTACTCTCCTCCCAGTGCCCTCTCCACTCTGGATGTTGAATTGCCGCCTGTTTGTTACGATGCAGATATTTAAACTTCTTACTTCTTTG

TAGTTTCTGTATGTATGTTGTATTAATAAAGCATTTGTGC
Translation
 - UNI25394 - MATLIFVDKDNEEPGRRLASKDGLKLGTGV - UNI25394 - VKALDGKLQVSTPRVGKVFNAPAVPKASRKALGTVNRVAEKP

MKTGKPLQPKQPTLTGKK - UNI21768 - ITEKSTKTQSSVPAPDDAYPEIEKFFPFNPLD DFESFDLPEEHQISLLPLNGVPLMTLNEERGLEKL

LHLGPPSPLKTPFLSWESD DPLYSPPSALSTLDVELPPVCYDADI
Transcript ENSMUST00000020687
Sequence
GAGTTACAGTTTAAACTGCGGTGTGCCGGGTCGTTGGTGGCGCAGTCTTCG - UNI25394 - AGTAATCCAGAATGGCTACTCTTATCTTTGTTGAT

AAGGATAATGAAGAACCCGGCCGCCGTTTGGCATCTAAGGATGGGTTGAAGCTGGGCACTGGTG - UNI25394 - TCAAGGCCTTAGATGGGAAATT

GCAGGTTTCAACGCCTCGAGTCGGCAAAGTGTTCAATGCTCCAGCCGTGCCTAAAGCCAGCAGAAAGGCTTTGGGGACAGTCAACAGAGTTGCCGAAAAG

CCTATGAAGACTGGCAAACCCCTCCAACCAAAACAGCCGACCTTGACTGGGAAAAAG - UNI21768 - ATCACCGAGAAGTCTACTAAGACACAAAG

TTCTGTTCCTGCTCCTGATGATGCCTACCCAGAAATAGAAAAGTTCTTCCCTTTCAATCCTCTAG ACTTTGAGAGTTTTGACCTGCCTGAGGAGCACCA

GATCTCACTTCTCCCCTTGAATGGCGTGCCTCTCATGACCCTGAATGAAGAGAGAGGGCTGGAGAAGCTGCTGCATCTGGGCCCCCCTAGCCCTCTGAAG

ACACCCTTTCTATCATGGGAATCTG ATCCGCTGTACTCTCCTCCCAGTGCCCTCTCCACTCTGGATGTTGAATTGCCGCCTGTTTGTTACGATGCAGAT

ATTTAAACTTCTTACTTCTTTGTAGTTTCTGTATGTATGTTGTATTAATAAAGCATTTGTGC
Translation
 - UNI25394 - MATLIFVDKDNEEPGRRLASKDGLKLGTGV - UNI25394 - VKALDGKLQVSTPRVGKVFNAPAVPKASRKALGTVNRVAEKP

MKTGKPLQPKQPTLTGKK - UNI21768 - ITEKSTKTQSSVPAPDDAYPEIEKFFPFNPLD DFESFDLPEEHQISLLPLNGVPLMTLNEERGLEKL

LHLGPPSPLKTPFLSWESD DPLYSPPSALSTLDVELPPVCYDADI

For any suggestions or comments, please send an email to unitrap@crg.es