Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020448 (Rnf185)
Chromosomal location
Chr 11: 3315985 - 3352366 (-)
Description
ring finger protein 185 Gene [Source:MGI (curated);Acc:Rnf185-002]
RefSeq_dna
NM_145355 
RefSeq_peptide
NP_663330.2 
UniGene
Mm.136973 Mm.406576 
MGI
MGI:1922078 
Uniprot/SWISSPROT
Q91YT2 
Human Ortholog
ENSG00000138942 (RNF185)
Omim not available
UniTrap UNI12479
Vector Insertion
Chr 11: 3352211 - 3352310
Public Clones W167E02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29647
Vector Insertion
Chr 11: 3338207 - 3352310
Public Clones (sanger) E127G06 (ggtc) IST10332D12 (tigm) IST11690H1 (tigm) IST14487A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17496
Vector Insertion
Chr 11: 3332402 - 3332624
Public Clones not available
Private Clones OST441716 (lexicon) OST422304 (lexicon) OST352110 (lexicon) OST268411 (lexicon)
OST222726 (lexicon) OST221031 (lexicon) OST205458 (lexicon) OST201384 (lexicon)
OST45670 (lexicon) OST32845 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28263
Vector Insertion
Chr 11: 3328906 - 3332402
Public Clones not available
Private Clones OST35782 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38345
Vector Insertion
Chr 11: 3319864 - 3325340
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000077078
Sequence
ATCTTTCTGACTGACGCGTCTCTAAGACTGGCTCGGCTACTCCGGGACGGGGGAACGGACAGCTGGCGTCGCTGGCGCTCGCTCTACCGCGGCGGCAG -

 UNI12479 - - UNI17496 - - UNI29647 - GATTGTCTTGAGAATCTTCCCTGGAAGCTTTGCTGGCAAGCAGCCATGGCAAGTAAAGGGCC

TTCGGCCTCTGCATCCACTGAGAATTCCAATGCAGGGGGGCCCAGTGGCAGCAGCAATGGCACTGGTGAGAGTGGAGGGCAGGACAGCACCTTTGAGTGC

AACATATGCCTGGACACAGCCAAGGATGCTGTCATCAGCCTGTGTGGCCACCTCTTCTG - UNI17496 - - UNI28263 - TTGGCCGTGTTTAC

ATCAG TGGTTGGAGACTAGGCCTAACAGACAAGTGTGTCCAGTCTGCAAAGCTGGCATCAGCCGAGACAAAGTCATCCCCCTCTATGGCAGAGGCAGCA

CTGGACAGCAGGATCCCAG AGAGAAGACTCCTCCTCGTCCTCAAGGCCAGAGGCCAGAGCCAGAAAATAGAGGG GGATTTCAAGGATTTGGATTTGGA

GATGGTGGCTTTCAGATGTCTTTTGGAATTGGAGCATTTCCATTTGGGATATTTGCCACAGCATTTAACATAAATGATGGACGGCCTCCTCCAG CTGTC

CCTGGGACACCCCAGTATGTGGATGAGCAGTTCCTGTCACGCCTCTTCCTGTTTGTCGCCCTGGTGATCATGTTCTGGCTCCTGATCGCCTAATACAGGA

CCCTGTTAACATCTACAGCAGCGCCTCTGGACTGGTGATATGCCGCACCCACTCCTGTGTTTGATTTGTTTAATCCTGACCCAGGGATCAAGGGTCAGAG

ACACACCAAGGAGTTGGAACTCAAAACCAAAGGAACCCCCAATTTCACCACTGCTGTAAACACTCTTGTATAACCTCAGGTCTTGTGCTGAATCTCCTCT

CATGGGTGGCAGTGTGAAGTCCTGCTCCAGCCTTCTCAGCAGGTCCCAGCTCTACACAGGGAAGAGATGGGAAGAAAGAAACAGTTTCTTTAACAAGAAC

TTTAAATTACAAAAATGAAGGGATGAACCAAATGGTATTTACAGAAACTTACTTTCATCTTTTTACATACTCCTTGGTAAGTGGCCTCCACTCCCTATCC

TGAGAGACTCCCTTCCACATCCCAGTACTGCTCCTCCCACCTCCCGCTTCCTCAGCAAAGACATAAGAAGGTCGGTCGGTTGCAGCAGCAGAAACTGAAA

ATGCTGATGACCTTACCAGAGACTCTGGTTTTTGATTGGCTCTGGGCCTTGTTCAGTGTCTTGACCCTAGAAAGCAGCTTAGATGACCTGCTGGCTTCCT

GGTATAGATTGTCCCTGATGTCACTGGGCTCAAATTTCCCATCAGCCTTCTCTAGACTTCTGCTGAATTCAAGACTGACTGTTATGCTTTAGGGCTGATA

CAAGAATAACAGGACAGGTTGCCCTGCCCTAGGCTACAGAAGCCTGAGTCATTCTCTCACAGAACTTGCCCAGAGAAACTGGAGGCTTTCTCAGGTCAGC

CCAGCTGCATGTAGAACACTACTACCCTCAGAAGCCATTGTCCTTTTTAAAAAAGGTTACGACGCTGACTCCATCTGATGGTGAAAACTCCTTGAATGTG

TGCTGAGCCCAGGGATACATGAGGCTCCTGAGCAAGCAACCCCTCTCTGGTGACATAACACAAGGACCTCAGAGATACAGTGTGGTCGACATTCCTTAGT

CTTCCTCGTGTTGATTTGTTCTTGAACTTATAAGCTGTTTCCTCTGAATCTGATTGTGGGATTGTGTTGACAGGCAGGAGAATAGTCACCTGCTGAGACG

GTTCTTGCTCTGCCCATCAGGCCTCATCTTAGAAATGTCACCTCTCCCTGGAGACCTCAGCAGGGCAGCAAGATAAGCGTCTACTGGACCCTTTTGTTCA

CTTCTCCAACACCCACTGCCCCAGCAATAACAAACTGGGAGAAAGCCTTGCCTGGTGATTTTTCTAGATGTGACTCTATATAATCTCTGGAACCCTAGAC

CTTGAGGATGGTGAAAGAGCCCTCCTCCTCACAGCACAATCCTTACCTGCCAACGCCAGTGTTAGTGTTGAAATGAATACAGTATGAGTATTGTGTAGGA

GGGTGGTTTGGCAACTCTAGCTGTTAAGAATAAGCCACCAAATTTATGGTATGCCTGACAGATTTTAAATATTCTTTGGCGCTTGGAAATCCCTGGTCAC

GGGGCCCCTGGAGTGTCTCTGTTCTAGAGAGAATTGGTAGGATCCCTCAGTGTAGCATAGCCCTAAGTAGTAGAGGGAAAACTTAAGCCAATGAACACAA

AGGAGATGAGAGAGGGATTGTGAGTAGTGGAGTAAACCATTTGGAATCTGGTGAAATGGATGACCCAGGTGTGCAGCAGCAGAGTCATCGCAGGGCATGC

AGTAGCACAGCTGTGGTGGCATGTGCCCCTGTGAACATTAACATAACAGGGCTATACATCTGCCAGCAGCTGAGGCTAGACAGCCAACTTGGACTTTATG

GGCCATTCCTCTACAGGCTCACCACTCATCCCATGGCCAAGGCAGCTTTCCCTTCTGTGTTTTCTGTGTCCTCAGCCTCCACCTTTCTGCCACCCACATG

GACAAGGACAATGGGAACATGTAAGGCCGCATACCCTGACCAGCCACTGATTTTCACTGTTGTGAAAGTGATTTGACTTAGAATTAAATGGTTTTACATT

Translation
 - UNI12479 - - UNI17496 - - UNI29647 - MASKGPSASASTENSNAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFC 

- UNI17496 - - UNI28263 - CWPCLHQ WLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPR REKTPPRPQGQRPEPENRG GFQGFGF

GDGGFQMSFGIGAFPFGIFATAFNINDGRPPPA AVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA
Transcript ENSMUST00000064364
Sequence
CTAGAGGCGGCTCCGCGTCAGGTGACCAAGTTCCCGGTAGGAGGGGTCGGAGGTTCAATCTTTCTGACTGACGCGTCTCTAAGACTGGCTCGGCTACTCC

GGGACGGGGGAACGGACAGCTGGCGTCGCTGGCGCTCGCTCTACCGCGGCGGCAG - UNI12479 - - UNI29647 - GCTCCTCCTACGCTGACT

TTTGGCTCAGTGACTTCAACACCTGCCTGTTGTGCTGTATGTGTATCCTCCTCTGCCCTCACATGTTCTGCAGACCTATCAATCAACGCCAAGCAGACTG

G - UNI17496 - - UNI29647 - GATTGTCTTGAGAATCTTCCCTGGAAGCTTTGCTGGCAAGCAGCCATGGCAAGTAAAGGGCCTTCGGCCTCT

GCATCCACTGAGAATTCCAATGCAGGGGGGCCCAGTGGCAGCAGCAATGGCACTGGTGAGAGTGGAGGGCAGGACAGCACCTTTGAGTGCAACATATGCC

TGGACACAGCCAAGGATGCTGTCATCAGCCTGTGTGGCCACCTCTTCTG - UNI17496 - - UNI28263 - TTGGCCGTGTTTACATCAG TGGT

TGGAGACTAGGCCTAACAGACAAGTGTGTCCAGTCTGCAAAGCTGGCATCAGCCGAGACAAAGTCATCCCCCTCTATGGCAGAGGCAGCACTGGACAGCA

GGATCCCAG AGAGAAGACTCCTCCTCGTCCTCAAGGCCAGAGGCCAGAGCCAGAAAATAGAGGG GGATTTCAAGGATTTGGATTTGGAGATGGTGGCT

TTCAGATGTCTTTTGGAATTGGAGCATTTCCATTTGGGATATTTGCCACAGCATTTAACATAAATGATGGACGGCCTCCTCCAG CTGTCCCTGGGACAC

CCCAGTATGTGGATGAGCAGTTCCTGTCACGCCTCTTCCTGTTTGTCGCCCTGGTGATCATGTTCTGGCTCCTGATCGCCTAATACAGGACCCTGTTAAC

ATCTACAGCAGCGCCTCTGGACTGGTGATATGCCGCACCCACTCCTGTGTTTGATTTGTTTAATCCTGACCCAGGGATCAAGGGTCAGAGACACACCAAG

GAGTTGGAACTCAAAACCAAAGGAACCCCCAATTTCACCACTGCTGTAAACACTCTTGTATAACCTCAGGTCTTGTGCTGAATCTCCTCTCATGGGTGGC

AGTGTGAAGTCCTGCTCCAGCCTTCTCAGCAGGTCCCAGCTCTACACAGGGAAGAGATGGGAAGAAAGAAACAGTTTCTTTAACAAGAACTTTAAATTAC

AAAAATGAAGGGATGAACCAAATGGTATTTACAGAAACTTACTTTCATCTTTTTACATACTCCTTGGTAAGTGGCCTCCACTCCCTATCCTGAGAGACTC

CCTTCCACATCCCAGTACTGCTCCTCCCACCTCCCGCTTCCTCAGCAAAGACATAAGAAGGTCGGTCGGTTGCAGCAGCAGAAACTGAAAATGCTGATGA

CCTTACCAGAGACTCTGGTTTTTGATTGGCTCTGGGCCTTGTTCAGTGTCTTGACCCTAGAAAGCAGCTTAGATGACCTGCTGGCTTCCTGGTATAGATT

GTCCCTGATGTCACTGGGCTCAAATTTCCCATCAGCCTTCTCTAGACTTCTGCTGAATTCAAGACTGACTGTTATGCTTTAGGGCTGATACAAGAATAAC

AGGACAGGTTGCCCTGCCCTAGGCTACAGAAGCCTGAGTCATTCTCTCACAGAACTTGCCCAGAGAAACTGGAGGCTTTCTCAGGTCAGCCCAGCTGCAT

GTAGAACACTACTACCCTCAGAAGCCATTGTCCTTTTTAAAAAAGGTTACGACGCTGACTCCATCTGATGGTGAAAACTCCTTGAATGTGTGCTGAGCCC

AGGGATACATGAGGCTCCTGAGCAAGCAACCCCTCTCTGGTGACATAACACAAGGACCTCAGAGATACAGTGTGGTCGACATTCCTTAGTCTTCCTCGTG

TTGATTTGTTCTTGAACTTATAAGCTGTTTCCTCTGAATCTGATTGTGGGATTGTGTTGACAGGCAGGAGAATAGTCACCTGCTGAGACGGTTCTTGCTC

TGCCCATCAGGCCTCATCTTAGAAATGTCACCTCTCCCTGGAGACCTCAGCAGGGCAGCAAGATAAGCGTCTACTGGACCCTTTTGTTCACTTCTCCAAC

ACCCACTGCCCCAGCAATAACAAACTGGGAGAAAGCCTTGCCTGGTGATTTTTCTAGATGTGACTCTATATAATCTCTGGAACCCTAGACCTTGAGGATG

GTGAAAGAGCCCTCCTCCTCACAGCACAATCCTTACCTGCCAACGCCAGTGTTAGTGTTGAAATGAATACAGTATGAGTATTGTGTAGGAGGGTGGTTTG

GCAACTCTAGCTGTTAAGAATAAGCCACCAAATTTATGGTATGCCTGACAGATTTTAAATATTCTTTGGCGCTTGGAAATCCCTGGTCACGGGGCCCCTG

GAGTGTCTCTGTTCTAGAGAGAATTGGTAGGATCCCTCAGTGTAGCATAGCCCTAAGTAGTAGAGGGAAAACTTAAGCCAATGAACACAAAGGAGATGAG

AGAGGGATTGTGAGTAGTGGAGTAAACCATTTGGAATCTGGTGAAATGGATGACCCAGGTGTGCAGCAGCAGAGTCATCGCAGGGCATGCAGTAGCACAG

CTGTGGTGGCATGTGCCCCTGTGAACATTAACATAACAGGGCTATACATCTGCCAGCAGCTGAGGCTAGACAGCCAACTTGGACTTTATGGGCCATTCCT

CTACAGGCTCACCACTCATCCCATGGCCAAGGCAGCTTTCCCTTCTGTGTTTTCTGTGTCCTCAGCCTCCACCTTTCTGCCACCCACATGGACAAGGACA

ATGGGAACATGTAAGGCCGCATACCCTGACCAGCCACTGATTTTCACTGTTGTGAAAGTGATTTGACTTAGAATTAAATGGTTTTACATTA
Translation
 - UNI12479 - - UNI29647 - MCILLCPHMFCRPINQRQADW - UNI17496 - - UNI29647 - DCLENLPWKLCWQAAMASKGPSASA

STENSNAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFC - UNI17496 - - UNI28263 - CWPCLHQ WLETRPNRQVCPVCKA

GISRDKVIPLYGRGSTGQQDPR REKTPPRPQGQRPEPENRG GFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPA AVPGTPQYVDEQFLSR

LFLFVALVIMFWLLIA
Transcript ENSMUST00000110026
Sequence
ATGTGTATCCTCCTCTGCCCTCACATGTTCTGCAGACCTATCAATCAACGCCAAGCAGACTGG - UNI17496 - - UNI29647 - GATTGTCTTG

AGAATCTTCCCTGGAAGCTTTGCTGGCAAGCAGCCATGGCAAGTAAAGGGCCTTCGGCCTCTGCATCCACTGAGAATTCCAATGCAGGGGGGCCCAGTGG

CAGCAGCAATGGCACTGGTGAGAGTGGAGGGCAGGACAGCACCTTTGAGTGCAACATATGCCTGGACACAGCCAAGGATGCTGTCATCAGCCTGTGTGGC

CACCTCTTCTG - UNI17496 - - UNI28263 - TTGGCCGTGTTTACATCAG TGGTTGGAGACTAGGCCTAACAGACAAGTGTGTCCAGTCTGC

AAAGCTGGCATCAGCCGAGACAAAGTCATCCCCCTCTATGGCAGAGGCAGCACTGGACAGCAGGATCCCAG AGAGAAGACTCCTCCTCGTCCTCAAGGC

CAGAGGCCAGAGCCAGAAAATAGAGGG GGATTTCAAGGATTTGGATTTGGAGATGGTGGCTTTCAGATGTCTTTTGGAATTGGAGCATTTCCATTTGGG

ATATTTGCCACAGCATTTAACATAAATGATGGACGGCCTCCTCCAG CTGTCCCTGGGACACCCCAGTATGTGGATGAGCAGTTCCTGTCACGCCTCTTC

CTGTTTGTCGCCCTGGTGATCATGTTCTGGCTCCTGATCGCCTAATACAGGACCCTGTTAACATCTACAGCAGCGCCTCTGGACTGGTGATATGCCGCAC

CCACTCCTGTGTTTGATTTGTTTAATCCTGACCCAGGGATCAAGGGTCAGAGACACACCAAGGAGTTGGAACTCAAAACCAAAGGAACCCCCAATTTCAC

CACTGCTGTAAACACTCTTGTATAACCTCAGGTCTTGTGCTGAATCTCCTCTCATGGGTGGCAGTGTGAAGTCCTGCTCCAGCCTTCTCAGCAGGTCCCA

GCTCTACACAGGGAAGAGATGGGAAGAAAGAAACAGTTTCTTTAACAAGAACTTTAAATTACAAAAATGAAGGGATGAACCAAATGGTATTTACAGAAAC

TTACTTTCATCTTTTTACATACTCCTTGGTAAGTGGCCTCCACTCCCTATCCTGAGAGACTCCCTTCCACATCCCAGTACTGCTCCTCCCACCTCCCGCT

TCCTCAGCAAAGACATAAGAAGGTCGGTCGGTTGCAGCAGCAGAAACTGAAAATGCTGATGACCTTACCAGAGACTCTGGTTTTTGATTGGCTCTGGGCC

TTGTTCAGTGTCTTGACCCTAGAAAGCAGCTTAGATGACCTGCTGGCTTCCTGGTATAGATTGTCCCTGATGTCACTGGGCTCAAATTTCCCATCAGCCT

TCTCTAGACTTCTGCTGAATTCAAGACTGACTGTTATGCTTTAGGGCTGATACAAGAATAACAGGACAGGTTGCCCTGCCCTAGGCTACAGAAGCCTGAG

TCATTCTCTCACAGAACTTGCCCAGAGAAACTGGAGGCTTTCTCAGGTCAGCCCAGCTGCATGTAGAACACTACTACCCTCAGAAGCCATTGTCCTTTTT

AAAAAAGGTTACGACGCTGACTCCATCTGATGGTGAAAACTCCTTGAATGTGTGCTGAGCCCAGGGATACATGAGGCTCCTGAGCAAGCAACCCCTCTCT

GGTGACATAACACAAGGACCTCAGAGATACAGTGTGGTCGACATTCCTTAGTCTTCCTCGTGTTGATTTGTTCTTGAACTTATAAGCTGTTTCCTCTGAA

TCTGATTGTGGGATTGTGTTGACAGGCAGGAGAATAGTCACCTGCTGAGACGGTTCTTGCTCTGCCCATCAGGCCTCATCTTAGAAATGTCACCTCTCCC

TGGAGACCTCAGCAGGGCAGCAAGATAAGCGTCTACTGGACCCTTTTGTTCACTTCTCCAACACCCACTGCCCCAGCAATAACAAACTGGGAGAAAGCCT

TGCCTGGTGATTTTTCTAGATGTGACTCTATATAATCTCTGGAACCCTAGACCTTGAGGATGGTGAAAGAGCCCTCCTCCTCACAGCACAATCCTTACCT

GCCAACGCCAGTGTTAGTGTTGAAATGAATACAGTATGAGTATTGTGTAGGAGGGTGGTTTGGCAACTCTAGCTGTTAAGAATAAGCCACCAAATTTATG

GTATGCCTGACAGATTTTAAATATTCTTTGGCGCTTGGAAATCCCTGGTCACGGGGCCCCTGGAGTGTCTCTGTTCTAGAGAGAATTGGTAGGATCCCTC

AGTGTAGCATAGCCCTAAGTAGTAGAGGGAAAACTTAAGCCAATGAACACAAAGGAGATGAGAGAGGGATTGTGAGTAGTGGAGTAAACCATTTGGAATC

TGGTGAAATGGATGACCCAGGTGTGCAGCAGCAGAGTCATCGCAGGGCATGCAGTAGCACAGCTGTGGTGGCATGTGCCCCTGTGAACATTAACATAACA

GGGCTATACATCTGCCAGCAGCTGAGGCTAGACAGCCAACTTGGACTTTATGGGCCATTCCTCTACAGGCTCACCACTCATCCCATGGCCAAGGCAGCTT

TCCCTTCTGTGTTTTCTGTGTCCTCAGCCTCCACCTTTCTGCCACCCACATGGACAAGGACAATGGGAACATGTAAGGCCGCATACCCTGACCAGCCACT

GATTTTCACTGTTGTGAAAGTGATTTGACTTAGAATTAAATGGTTTTACATT
Translation
MCILLCPHMFCRPINQRQADW - UNI17496 - - UNI29647 - DCLENLPWKLCWQAAMASKGPSASASTENSNAGGPSGSSNGTGESGGQDSTF

ECNICLDTAKDAVISLCGHLFC - UNI17496 - - UNI28263 - CWPCLHQ WLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPR REKT

PPRPQGQRPEPENRG GFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPA AVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA

For any suggestions or comments, please send an email to unitrap@crg.es