Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020455 (Trim11)
Chromosomal location
Chr 11: 58791595 - 58804959 (+)
Description
tripartite motif-containing 11 Gene [Source:MGI (curated);Acc:Trim11-002]
RefSeq_dna
NM_053168 
RefSeq_peptide
NP_444398.1 
UniGene
Mm.468959 Mm.399599 
MGI
MGI:2137355 
Uniprot/SWISSPROT
Q99PQ2 
Uniprot/SPTREMBL
A2AB83 Q3TCL5 A2AB84 
Human Ortholog
ENSG00000154370 (TRIM11)
Omim not available
UniTrap UNI7820
Vector Insertion
Chr 11: 58792147 - 58794742
Public Clones RRP011 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7380
Vector Insertion
Chr 11: 58795726 - 58801134
Public Clones RRS409 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9412
Vector Insertion
Chr 11: 58802337 - 58802432
Public Clones XH895 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108809
Sequence
GAGAGCTTAGTGCCGGATGTACCCACTACCCAGGAGGCTGAGAGTGCCGCTACCTGCTCCTGGCCCGTTCCCACTGCGCTCTCGCGGCGGAGTTGCCCGA

TCCCGGTGCACCACGAAAAGCTCGATCCAGGCGCAGACGCCAGCACCATGGCTGCCCCAGACTTGTCCACCAACCTCCAGGAGGAGGCCACCTGCGCCAT

CTGCCTGGATTACTTCACCGACCCGGTGATGACCGACTGCGGCCACAACTTCTGCCGCGAGTGCATCCGACGTTGCTGGGGCCAGCCCGAGGGCCCATAC

GCGTGCCCCGAGTGTCGCGAGCTGTCGGCGCAGAGGAACCTACGGCCCAACCGCCCGCTCGCCAAAATGGCAGAAATGGCACGACGCCTGCACCCGCCTT

CTCCGGTCCCGCAGGGCGTCTGTGCGGCGCACCGCGAGCCGCTGACCACCTTCTGCGGCGACGACCTCAGCCTGCTGTGCCCCATCTGCGAGCGTTCGGA

GCACTGGACTCACCGGGTGAGACCGCTGCAGGAGGCGGCGGACGACCTCAAG - UNI7820 - GGGAGGCTGGAGAAGTCACTGGAGCACCTACGGAA

ACAAATGGAGGACGCAATGCTGTTCCAAGCCCAGGCTGAGGAAACCTGTGCCTTGTGGCAG AAGATGGTGGAGAGCCAGCGGCAGAATGTGCTGGGCGA

GTTTGAGAGGCTGCGCCGCCTGTTGGCAGAGGAGGAGCAACAGCTGCTGCAGAAGCTGGAGGAGGAAGAGCTGGAGGTTCTGCCGCGCCTGCGTGAAGGC

GCTGCGAGGCTTGGCCAGCAAAGCACGCAGCTGGCAGCCCTCATCTCCGAGCTTGAGAGCCGCTGCCAGCTGCCAGCCCTGGGTTTACTGCAG - UNI7

380 - GACATTAAGGACGCCCTGTGCAG - UNI9412 - GATGTGAAGCTGCAGCCTCCAGCAGTGGTGCCCATGGAGCTGAGGACCGTGTGCCGGG

TCCCAGGGCTGGTGGAGACCCTGCGGAGGTTCCGAGGTGGGTGCACAGTCCTTGGAGCGGAACTGTTGGGAGCCCCAGGACTTAACATCGATCCAGTAGC

TTAGAACAGCAGTTCTAGAAACTTCCCTCTGCTTTACACATGTGTGTGTATTTTCCAAACTAAGCAGTTCTCCATCAGGCCCAGTCCCCCAAGACTGACC

TACTTCAGATGCTACTTGTGAGCCCCAGGGAATGCCCCTATCTCTGTCTCCTTGCTCTTACTCCAGTCCTCACAACCCCTATCTAGTTAATGTTATGTGA

TTTGCTGGGTGGCTCACAAAACCCAGGAATCCTTTTGCTTAGTTTTAACAGTTAAAGAAGCTGCAGTTAAGGAAGAGATGGTGGGTAAGGCTGCAGGAAG

GCATGAAGCCCTCCTGCACTCGCTGCGAGGACTGTCCCTTCAGCTCACTGTCCCTTGGACCTGACCTTTGAGGAACTTTTAGGGATGTTCTGTTCTGTGG

GCATAGTATGTCAGATGCTTGTCTGCAAACTTGCCCCCTGACTCCTGTCTTCTCCCTGGAGCCAATGAATGAGGCTGAAGTTCCTTCTGTCGCACAGCTG

GTTTATGGTGGCCAGCACCATCCTGAAGCGATCAACAAGACCCCACCTGAGCCACCTTAGAAACATAAGTTCAAGTGTGATGTCAGGGGACTCTTAGGAT

TGGCAAAGCAGATTTTTAGGTCTTCTCTGGAGCCAGGAATGAACTCTGCTGTTAAGTCTTGGTTGTCCAGGGGCTGCTGCCCTTGCTTCTAGACAGAGGT

CGACTGTATGTGGACCATGCCAGGCCCAGAGGTAGGTAGACCAGAAATCAGCCGGGACTGTGGTCTGGGAGGAAACAGCACCCTTCCTCCTGAGCAGCTC

TGTGTTACCCTGGGAGCCACCAGAATGCTGTGGGGCCTAGGGTACAGCTGCAACCCAAACCCACAGTCTTCTGCTGGAGATTGAAAGAAAGAGCAGATGT

GGGGAGTGGTCATGGTGGGGGCAGAAGATGATCCGGGGCTACATGAGACCCTTCAAGAAGGTAAATGAAAATGCAGTCAGAGCCCTGAGACCAGAAGCAG

AGATGCAGGGCTGCTTTCTAGAGTTAAGATAGAGCTAGGGGTTCTCTCCCAGGGAAGGGAAGTTCTCCACTAGGGGTACTTACTTAAGCCTGAGGCTCCA

ACAGCCACGTGGACTGCCAGGAAAGGTTTGGCTGATCGCTAGAGCAGTAGGGGACTAACTTGGGAGTCTGGTTGACCTCAGGCTTTTATACAGGGGACAT

AACCCTGGACCCAGACACCGCCAACCCTGAGCTGGTCTTATCTGAGGACCGGAGGAGTGTGCAGCGTGGTGAACAGCGGCAGGCCCTGCCTGACAACCCA

GAGCGGTTCGACCCCGGCCCTTGCGTGCTGGGCCAGGAGCGCATTACCTCTGGCCGCCACTACTGGGAGGTGGAAGTCGGGGACCAGACCAGCTGGGCAC

TCGGCGTGTGTAAAGAAACTGCCAACAGGAAGGAGAAGGGGGAGCTGTCGGCTGGCAATGGGTTCTGGATCCTGGTGTTCCTGGGGAGTTTCTATAATTC

CAATGAGCCGGCCTTCTCCCCACTGCGGGACCCTCCCAAGCGTGTGGGGATTTTTCTGGACTATGAAGCTGGCCATCTCTCATTCTACAGTGCCACGGAT

GGGTCGCTGCTGTTTATCTTCCCCGAGACCCTGTTCTCAGGGACACTCCGGCCCCTCTTCTCACCTCTGTCAAGCAGCCCGACCCCTATGACTATCTGCA

GGCTGATAGGTGTATCTGGGGACACCCTTGGCCCGCAGTGACCCAAACCTTCTAAGAAAGTCCCTTCACCTTTCCTGGTCCTTTGTCCTGGCCATACAGA

GACCCAGGAGCCAGCTGACATCCTGTGCGCATTAGGAGGAGCACACAGTGCCTTTCTGACCACACGTGGGAAACACAAGTTCTCTGTCTCAGAGACAGTA

TGTGTGAGAGTACACTGGGCTGGGCTCTGTCCTCATCCTGGGGATCCTCCCCGCCCCCCGATGCCACTTAGTGCCGAAAGCTCTCACCAAAGCACTAAGT

CCCATGTGTCACCAGCACCTCAGATTCTGAGTTCCTGGGCTGCCTGCCAAGCATGCCACACAGTCCCTGGAGTGATAGGGATTAGGTAGGGAGACAGCTT

CAAGCATCTCTGGATTTGGTCTGATAAACGGGAAGGCTGCTCAGAGTCCTGACCTTGCTGGGCGTGGCTACAAAGAGGACGGTAGCGTGGCCCCAGAGAT

GAAGCAATCTAGTAGGGGCTGAATCCTACAGGAGTATTCAACATTTGTATTCGGCACATAAGGGGCCTAGAAGTAGAACGCAGAAATGACACTTGAACAC

ACCCTTCTGTCCTGAGACTTGTCTGGTGGCTGGCTGTGGTACACTGCCCCTGGTTGCAGACTGAGCTGCACAGGAGTCAGTAGTGACTGCTTTTGTATTA

AACTTTGGGAGTTTTATCTTCTATTTATTGAAAGGGAAACATTTAAATAAACTCATTTGAAG
Translation
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELSAQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCAAHREPLT

TFCGDDLSLLCPICERSEHWTHRVRPLQEAADDLK - UNI7820 - GRLEKSLEHLRKQMEDAMLFQAQAEETCALWQ KMVESQRQNVLGEFERLRR

LLAEEEQQLLQKLEEEELEVLPRLREGAARLGQQSTQLAALISELESRCQLPALGLLQ - UNI7380 - DIKDALCR - UNI9412 - RM
Transcript ENSMUST00000093061
Sequence
GCTGAGAGTGCCGCTACCTGCTCCTGGCCCGTTCCCACTGCGCTCTCGCGGCGGAGTTGCCCGATCCCGGTGCACCACGAAAAGCTCGATCCAGGCGCAG

ACGCCAGCACCATGGCTGCCCCAGACTTGTCCACCAACCTCCAGGAGGAGGCCACCTGCGCCATCTGCCTGGATTACTTCACCGACCCGGTGATGACCGA

CTGCGGCCACAACTTCTGCCGCGAGTGCATCCGACGTTGCTGGGGCCAGCCCGAGGGCCCATACGCGTGCCCCGAGTGTCGCGAGCTGTCGGCGCAGAGG

AACCTACGGCCCAACCGCCCGCTCGCCAAAATGGCAGAAATGGCACGACGCCTGCACCCGCCTTCTCCGGTCCCGCAGGGCGTCTGTGCGGCGCACCGCG

AGCCGCTGACCACCTTCTGCGGCGACGACCTCAGCCTGCTGTGCCCCATCTGCGAGCGTTCGGAGCACTGGACTCACCGGGTGAGACCGCTGCAGGAGGC

GGCGGACGACCTCAAG - UNI7820 - GGGAGGCTGGAGAAGTCACTGGAGCACCTACGGAAACAAATGGAGGACGCAATGCTGTTCCAAGCCCAGGC

TGAGGAAACCTGTGCCTTGTGGCAG AAGATGGTGGAGAGCCAGCGGCAGAATGTGCTGGGCGAGTTTGAGAGGCTGCGCCGCCTGTTGGCAGAGGAGGA

GCAACAGCTGCTGCAGAAGCTGGAGGAGGAAGAGCTGGAGGTTCTGCCGCGCCTGCGTGAAGGCGCTGCGAGGCTTGGCCAGCAAAGCACGCAGCTGGCA

GCCCTCATCTCCGAGCTTGAGAGCCGCTGCCAGCTGCCAGCCCTGGGTTTACTGCAG - UNI7380 - GACATTAAGGACGCCCTGTGCAG GGTGCA

GGATGTGAAGCTGCAGCCTCCAGCAGTGGTGCCCATGGAGCTGAGGACCGTGTGCCGGGTCCCAGGGCTGGTGGAGACCCTGCGGAGGTTCCGAG - UN

I9412 - GGGACATAACCCTGGACCCAGACACCGCCAACCCTGAGCTGGTCTTATCTGAGGACCGGAGGAGTGTGCAGCGTGGTGAACAGCGGCAGGCC

CTGCCTGACAACCCAGAGCGGTTCGACCCCGGCCCTTGCGTGCTGGGCCAGGAGCGCATTACCTCTGGCCGCCACTACTGGGAGGTGGAAGTCGGGGACC

AGACCAGCTGGGCACTCGGCGTGTGTAAAGAAACTGCCAACAGGAAGGAGAAGGGGGAGCTGTCGGCTGGCAATGGGTTCTGGATCCTGGTGTTCCTGGG

GAGTTTCTATAATTCCAATGAGCCGGCCTTCTCCCCACTGCGGGACCCTCCCAAGCGTGTGGGGATTTTTCTGGACTATGAAGCTGGCCATCTCTCATTC

TACAGTGCCACGGATGGGTCGCTGCTGTTTATCTTCCCCGAGACCCTGTTCTCAGGGACACTCCGGCCCCTCTTCTCACCTCTGTCAAGCAGCCCGACCC

CTATGACTATCTGCAGGCTGATAGGTGTATCTGGGGACACCCTTGGCCCGCAGTGACCCAAACCTTCTAAGAAAGTCCCTTCACCTTTCCTGGTCCTTTG

TCCTGGCCATACAGAGACCCAGGAGCCAGCTGACATCCTGTGCGCATTAGGAGGAGCACACAGTGCCTTTCTGACCACACGTGGGAAACACAAGTTCTCT

GTCTCAGAGACAGTATGTGTGAGAGTACACTGGGCTGGGCTCTGTCCTCATCCTGGGGATCCTCCCCGCCCCCCGATGCCACTTAGTGCCGAAAGCTCTC

ACCAAAGCACTAAGTCCCATGTGTCACCAGCACCTCAGATTCTGAGTTCCTGGGCTGCCTGCCAAGCATGCCACACAGTCCCTGGAGTGATAGGGATTAG

GTAGGGAGACAGCTTCAAGCATCTCTGGATTTGGTCTGATAAACGGGAAGGCTGCTCAGAGTCCTGACCTTGCTGGGCGTGGCTACAAAGAGGACGGTAG

CGTGGCCCCAGAGATGAAGCAATCTAGTAGGGGCTGAATCCTACAGGAGTATTCAACATTTGTATTCGGCACATAAGGGGCCTAGAAGTAGAACGCAGAA

ATGACACTTGAACACACCCTTCTGTCCTGAGACTTGTCTGGTGGCTGGCTGTGGTACACTGCCCCTGGTTGCAGACTGAGCTGCACAGGAGTCAGTAGTG

ACTGCTTTTGTATTAAACTTTGGGAGTTTTATCTTCTATTTATTGAAAGGGAAACATTTAAATAAACTCATTTGAAGTC
Translation
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELSAQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCAAHREPLT

TFCGDDLSLLCPICERSEHWTHRVRPLQEAADDLK - UNI7820 - GRLEKSLEHLRKQMEDAMLFQAQAEETCALWQ KMVESQRQNVLGEFERLRR

LLAEEEQQLLQKLEEEELEVLPRLREGAARLGQQSTQLAALISELESRCQLPALGLLQ - UNI7380 - DIKDALCR RVQDVKLQPPAVVPMELRTV

CRVPGLVETLRRFRG - UNI9412 - GDITLDPDTANPELVLSEDRRSVQRGEQRQALPDNPERFDPGPCVLGQERITSGRHYWEVEVGDQTSWALGV

CKETANRKEKGELSAGNGFWILVFLGSFYNSNEPAFSPLRDPPKRVGIFLDYEAGHLSFYSATDGSLLFIFPETLFSGTLRPLFSPLSSSPTPMTICRLI

GVSGDTLGPQ
Transcript ENSMUST00000108810
Sequence
GCTGAGAGTGCCGCTACCTGCTCCTGGCCCGTTCCCACTGCGCTCTCGCGGCGGAGTTGCCCGATCCCGGTGCACCACGAAAAGCTCGATCCAGGCGCAG

ACGCCAGCACCATGGCTGCCCCAGACTTGTCCACCAACCTCCAGGAGGAGGCCACCTGCGCCATCTGCCTGGATTACTTCACCGACCCGGTGATGACCGA

CTGCGGCCACAACTTCTGCCGCGAGTGCATCCGACGTTGCTGGGGCCAGCCCGAGGGCCCATACGCGTGCCCCGAGTGTCGCGAGCTGTCGGCGCAGAGG

AACCTACGGCCCAACCGCCCGCTCGCCAAAATGGCAGAAATGGCACGACGCCTGCACCCGCCTTCTCCGGTCCCGCAGGGCGTCTGTGCGGCGCACCGCG

AGCCGCTGACCACCTTCTGCGGCGACGACCTCAGCCTGCTGTGCCCCATCTGCGAGCGTTCGGAGCACTGGACTCACCGGGTGAGACCGCTGCAGGAGGC

GGCGGACGACCTCAAG - UNI7820 - GGGAGGCTGGAGAAGTCACTGGAGCACCTACGGAAACAAATGGAGGACGCAATGCTGTTCCAAGCCCAGGC

TGAGGAAACCTGTGCCTTGTGGCAG AAGATGGTGGAGAGCCAGCGGCAGAATGTGCTGGGCGAGTTTGAGAGGCTGCGCCGCCTGTTGGCAGAGGAGGA

GCAACAGCTGCTGCAGAAGCTGGAGGAGGAAGAGCTGGAGGTTCTGCCGCGCCTGCGTGAAGGCGCTGCGAGGCTTGGCCAGCAAAGCACGCAGCTGGCA

GCCCTCATCTCCGAGCTTGAGAGCCGCTGCCAGCTGCCAGCCCTGGGTTTACTGCAG - UNI7380 - CTCTGCATTGAGTGCTGCGCCCTGGAGAGA

GAAGCGTCTATAGCCAAG GACATTAAGGACGCCCTGTGCAG GGTGCAGGATGTGAAGCTGCAGCCTCCAGCAGTGGTGCCCATGGAGCTGAGGACCGT

GTGCCGGGTCCCAGGGCTGGTGGAGACCCTGCGGAGGTTCCGAG - UNI9412 - GGGACATAACCCTGGACCCAGACACCGCCAACCCTGAGCTGGT

CTTATCTGAGGACCGGAGGAGTGTGCAGCGTGGTGAACAGCGGCAGGCCCTGCCTGACAACCCAGAGCGGTTCGACCCCGGCCCTTGCGTGCTGGGCCAG

GAGCGCATTACCTCTGGCCGCCACTACTGGGAGGTGGAAGTCGGGGACCAGACCAGCTGGGCACTCGGCGTGTGTAAAGAAACTGCCAACAGGAAGGAGA

AGGGGGAGCTGTCGGCTGGCAATGGGTTCTGGATCCTGGTGTTCCTGGGGAGTTTCTATAATTCCAATGAGCCGGCCTTCTCCCCACTGCGGGACCCTCC

CAAGCGTGTGGGGATTTTTCTGGACTATGAAGCTGGCCATCTCTCATTCTACAGTGCCACGGATGGGTCGCTGCTGTTTATCTTCCCCGAGACCCTGTTC

TCAGGGACACTCCGGCCCCTCTTCTCACCTCTGTCAAGCAGCCCGACCCCTATGACTATCTGCAGGCTGATAGGTGTATCTGGGGACACCCTTGGCCCGC

AGTGACCCAAACCTTCTAAGAAAGTCCCTTCACCTTTCCTGGTCCTTTGTCCTGGCCATACAGAGACCCAGGAGCCAGCTGACATCCTGTGCGCATTAGG

AGGAGCACACAGTGCCTTTCTGACCACACGTGGGAAACACAAGTTCTCTGTCTCAGAGACAGTATGTGTGAGAGTACACTGGGCTGGGCTCTGTCCTCAT

CCTGGGGATCCTCCCCGCCCCCCGATGCCACTTAGTGCCGAAAGCTCTCACCAAAGCACTAAGTCCCATGTGTCACCAGCACCTCAGATTCTGAGTTCCT

GGGCTGCCTGCCAAGCATGCCACACAGTCCCTGGAGTGATAGGGATTAGGTAGGGAGACAGCTTCAAGCATCTCTGGATTTGGTCTGATAAACGGGAAGG

CTGCTCAGAGTCCTGACCTTGCTGGGCGTGGCTACAAAGAGGACGGTAGCGTGGCCCCAGAGATGAAGCAATCTAGTAGGGGCTGAATCCTACAGGAGTA

TTCAACATTTGTATTCGGCACATAAGGGGCCTAGAAGTAGAACGCAGAAATGACACTTGAACACACCCTTCTGTCCTGAGACTTGTCTGGTGGCTGGCTG

TGGTACACTGCCCCTGGTTGCAGACTGAGCTGCACAGGAGTCAGTAGTGACTGCTTTTGTATTAAACTTTGGGAGTTTTATCTTCTATTTATTGAAAGGG

AAACATTTAAATAAACTCATTTGAAGTC
Translation
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELSAQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCAAHREPLT

TFCGDDLSLLCPICERSEHWTHRVRPLQEAADDLK - UNI7820 - GRLEKSLEHLRKQMEDAMLFQAQAEETCALWQ KMVESQRQNVLGEFERLRR

LLAEEEQQLLQKLEEEELEVLPRLREGAARLGQQSTQLAALISELESRCQLPALGLLQ - UNI7380 - LCIECCALEREASIAK DIKDALCR RVQ

DVKLQPPAVVPMELRTVCRVPGLVETLRRFRG - UNI9412 - GDITLDPDTANPELVLSEDRRSVQRGEQRQALPDNPERFDPGPCVLGQERITSGR

HYWEVEVGDQTSWALGVCKETANRKEKGELSAGNGFWILVFLGSFYNSNEPAFSPLRDPPKRVGIFLDYEAGHLSFYSATDGSLLFIFPETLFSGTLRPL

FSPLSSSPTPMTICRLIGVSGDTLGPQ

For any suggestions or comments, please send an email to unitrap@crg.es