Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020460 (Rps27a)
Chromosomal location
Chr 11: 29445846 - 29447861 (-)
Description
ribosomal protein S27a Gene [Source:MGI (curated);Acc:Rps27a-003]
RefSeq_dna
NM_001033865 NM_024277 
RefSeq_peptide
NP_077239.1 NP_001029037.1 
UniGene
Mm.389352 Mm.460184 Mm.467138 Mm.422696 Mm.458088 
MGI
MGI:1925544 
Uniprot/SWISSPROT
P62983 P62991 
Uniprot/SPTREMBL
A5JUZ1 Q3TWD1 Q642L7 
Human Ortholog
not available
Omim not available
UniTrap UNI14827
Vector Insertion
Chr 11: 29447680 - 29447862
Public Clones PST7737-NL (escells) IST14786B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15305
Vector Insertion
Chr 11: 29447205 - 29447746
Public Clones H005E06 (ggtc) E112E10 (ggtc) PST7737-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18764
Vector Insertion
Chr 11: 29446789 - 29447205
Public Clones PST21867-NR (escells)
Private Clones OST414777 (lexicon) OST72819 (lexicon) OST37464 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38139
Vector Insertion
Chr 11: 29446290 - 29446789
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24999
Vector Insertion
Chr 11: 29446030 - 29446290
Public Clones not available
Private Clones OST198550 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102844
Sequence
TTTCCGATCCGCCATCGTGGGTGAGTGTATGCTCTGTGGCCGCGCTCTGGCTAGTGGCGCTACGCGTCGCTCTCACGGGTGTCGTCGGATCTAATCCGTC

TCTTTTCGAATGCAGGTGGAGCCGCCGCCACGATGCAGATCTTTGTGAAGACCCTTACGGGGAAAACCATCACGCTCGAG - UNI14827 - - UNI1

5305 - GTTGAACCCTCGGACACTATAGAAAATGTAAAGGCCAAGATCCAGGATAAGGAAG - UNI15305 - - UNI18764 - GAATTCCTCCT

GATCAGCAGAGGCTGATCTTTGCTGGTAAGCAGCTGGAAGATGGCCGGACTTTGTCTGACTACAACATTCAAAAG GAGTCCACCCTTCATCTGGTGTTG

AGACTTCGGGGTGGTGCTAAGAAAAGGAAGAAGAAGTCTTACACCACTCCCAAGAAGAACAAGCATAAGAGGAAGAAGGTTAAGTTGGCTGTGCTGAAAT

ACTATAAG - UNI24999 - GTGGATGAAAATGGCAAAATTAGCCGACTTCGTCGAGAGTGTCCTTCTGATGAATGTGGTGCTGGAGTTTTCATGGGA

AGCCACTTTGACAGGCATTACTGTGGCAAGTGTTGTCTGACTTACTGCTTCAACAAACCAGAAGACAAGTAGTTGTGTATGCGTTAATAAAAAGAAGGAA

CTCGTA
Translation
MQIFVKTLTGKTITLE - UNI14827 - - UNI15305 - VEPSDTIENVKAKIQDKEG - UNI15305 - - UNI18764 - GIPPDQQRLIF

AGKQLEDGRTLSDYNIQK ESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYK - UNI24999 - VDENGKISRLRRECPSDECGAGV

FMGSHFDRHYCGKCCLTYCFNKPEDK
Transcript ENSMUST00000102845
Sequence
CTTTCCGATCCGCCATCGTGG - UNI14827 - - UNI15305 - GTGGAGCCGCCGCCACGATGCAGATCTTTGTGAAGACCCTTACGGGGAAAAC

CATCACGCTCGAG - UNI14827 - - UNI15305 - GTTGAACCCTCGGACACTATAGAAAATGTAAAGGCCAAGATCCAGGATAAGGAAG - UN

I15305 - - UNI18764 - GAATTCCTCCTGATCAGCAGAGGCTGATCTTTGCTGGTAAGCAGCTGGAAGATGGCCGGACTTTGTCTGACTACAACA

TTCAAAAG GAGTCCACCCTTCATCTGGTGTTGAGACTTCGGGGTGGTGCTAAGAAAAGGAAGAAGAAGTCTTACACCACTCCCAAGAAGAACAAGCATA

AGAGGAAGAAGGTTAAGTTGGCTGTGCTGAAATACTATAAG - UNI24999 - GTGGATGAAAATGGCAAAATTAGCCGACTTCGTCGAGAGTGTCCT

TCTGATGAATGTGGTGCTGGAGTTTTCATGGGAAGCCACTTTGACAGGCATTACTGTGGCAAGTGTTGTCTGACTTACTGCTTCAACAAACCAGAAGACA

AGTAGTTGTGTATGCGTTAATAAAAAGAAGGAACTCGT
Translation
 - UNI14827 - - UNI15305 - MQIFVKTLTGKTITLE - UNI14827 - - UNI15305 - VEPSDTIENVKAKIQDKEG - UNI15305

 - - UNI18764 - GIPPDQQRLIFAGKQLEDGRTLSDYNIQK ESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYK - UNI2499

9 - VDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKPEDK

For any suggestions or comments, please send an email to unitrap@crg.es