Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020462 (Ccdc104)
Chromosomal location
Chr 11: 29121547 - 29147306 (-)
Description
coiled-coil domain containing 104 Gene [Source:MGI (curated);Acc:Ccdc104-001]
RefSeq_dna
NM_025740 
RefSeq_peptide
NP_080016.1 
UniGene
Mm.413366 
MGI
MGI:1913994 
Uniprot/SWISSPROT
Q8C6E0 
Uniprot/SPTREMBL
Q5SNY8 Q99JR9 
Human Ortholog
ENSG00000163001 (CCDC104)
Omim not available
UniTrap UNI1802
Vector Insertion
Chr 11: 29144161 - 29145085
Public Clones CC0336 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1496
Vector Insertion
Chr 11: 29134473 - 29144058
Public Clones CC0863 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093243
Sequence
ATGGGGAGGAAGAGCTTTCTAACAAACGAGATATACAAATGTGGCATTCTTTTGAAGGACCAGCATCAGTGCTTTCTGATCG TTTTTGATGATGAAGAA

GAAAGCAAATTAACCTACACAGAAATCCATCAAGAATACAAAGAGCTG - UNI1802 - GTTGAAAAGCTGTTAGAAAGTTACCTCAAAGAGATTGGA

ATTAATGAAGATCAGTTTCAAGAAGCGTGCACGTCCCCTCTGGCGAAGACGCGCACATCACAG - UNI1496 - GCCATTTTGCAGCCTGTGTTGGCA

GCAGAAGATTTTACTATCTTTAAAGCAATGATGGTCCAGAAGAACATTGAAATGCAGCTTCAAGCCATCCGAATAATCCAGGAGAGGAATG GTGTGTTA

CCTGACTGCTTAACTGATGGTGCAGATGTGGTCAGTGACCTTGAACAGGAAGAGATGAAAATTCTAAGAGAGGTCCTCAG AAAATCAAAAGAAGAATAT

GACCAGGAGGAAGAAAGGAAACGAAAAAAGCAG TCATCAGAGGCTAAAATGGAAGAACTGCCAGTATACACGAGTGAAGCTGAAAAAATGAGTAATTCC

CAAGGGGATGGTGAACACTTTGTACAGCCACCCTCAG AAGTTAAAGTGCATTTTGCTAATCAGTCAGTACAACCCTTGGCAAGAAAGATGGAGTTGTTG

CCTGAAACTTCCTCCCTCACACAAAAAGGTTTGAAGATACCTGGCTTAGAGCATGCAAGCATGGAAGGACCAATAGCA AATTTGTCAGCACTTGGAACA

GAAGAGTTACGTCAACGAGAGCATTATCTCAAGCAGAAGAGAGATAAGCTGCTGTCCATGAGAAAGGATACGAGGACAAAGCAGATCCAGAATACTGAGC

AAAAAGGAAAGCCTACCAGGGAGGCAGAG GAAATGACAGAGAAGCCAGAAATGACAGCAGAGGAGAAACAAACATTACTAAAGAGGCGATTGCTTGCAG

AGAAACTTAAAGAAGAAGTTATTAATAAGTAATATGAAAAATTAGCAAAACAGAAGCCCAAATTTTCTTAAAAATAAATTATTTAATCCTTAAACAAAGA

CTGTTAGTTTCAAGCAAATACTTGCTTTTCTAAATGCAACTGTGAACTGACTATTATTTTAAACAGGTAAAGGCAAGAGGGAAGGCAATTTAAAAAACGT

CTGCAGAAATCCAGGTATGATGGTGCATGCCTATAATCCTAGCACCCAGGATGCTGAATGAAGTAGAAGGATCAGGAGAACTCCTGGTCCTCTCCAGTGT

CAGAGCAAATTGGAGGCCAGCCTAGTTTACATGATGAGTCTGTCTCAAATAACCACAATAAATAAATTT
Translation
MGRKSFLTNEIYKCGILLKDQHQCFLIV VFDDEEESKLTYTEIHQEYKEL - UNI1802 - VEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQ -

 UNI1496 - AILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERNG GVLPDCLTDGADVVSDL     
Transcript ENSMUST00000020754
Sequence
GCTGCGTACGTTGTCATAGCGACCATTTTACGTTAACTGGTTTGTGGTGTCTAACCTGGGGGCCCGGCGATTGCGGGGACCTTGCTGCCCGCATTCTCCG

TCGCTTCCTGCGGCCGAAAGGCCAGACAGGGCTGGGGGAATCCGGCCTAGGCGTCCGCGTCGCCGGGTGCGAGCGGGATGGCTGCGGAAGAAGAGGACGA

AGTGGAATGGGTGGTGGAGAGCATCGCTGGGTTCCTGCGGGGCCCGGATTGGTCTATCCCCATCTTGGACTTTGTGGAGCAGAAATGCGAAG TTTTTGA

TGATGAAGAAGAAAGCAAATTAACCTACACAGAAATCCATCAAGAATACAAAGAGCTG - UNI1802 - GTTGAAAAGCTGTTAGAAAGTTACCTCAA

AGAGATTGGAATTAATGAAGATCAGTTTCAAGAAGCGTGCACGTCCCCTCTGGCGAAGACGCGCACATCACAG - UNI1496 - GCCATTTTGCAGCC

TGTGTTGGCAGCAGAAGATTTTACTATCTTTAAAGCAATGATGGTCCAGAAGAACATTGAAATGCAGCTTCAAGCCATCCGAATAATCCAGGAGAGGAAT

G GTGTGTTACCTGACTGCTTAACTGATGGTGCAGATGTGGTCAGTGACCTTGAACAGGAAGAGATGAAAATTCTAAGAGAGGTCCTCAG AAAATCAAA

AGAAGAATATGACCAGGAGGAAGAAAGGAAACGAAAAAAGCAG TCATCAGAGGCTAAAATGGAAGAACTGCCAGTATACACGAGTGAAGCTGAAAAAAT

GAGTAATTCCCAAGGGGATGGTGAACACTTTGTACAGCCACCCTCAG AAGTTAAAGTGCATTTTGCTAATCAGTCAGTACAACCCTTGGCAAGAAAGAT

GGAGTTGTTGCCTGAAACTTCCTCCCTCACACAAAAAGGTTTGAAGATACCTGGCTTAGAGCATGCAAGCATGGAAGGACCAATAGCA AATTTGTCAGC

ACTTGGAACAGAAGAGTTACGTCAACGAGAGCATTATCTCAAGCAGAAGAGAGATAAGCTGCTGTCCATGAGAAAGGATACGAGGACAAAGCAGATCCAG

AATACTGAGCAAAAAGGAAAGCCTACCAGGGAGGCAGAG GAAATGACAGAGAAGCCAGAAATGACAGCAGAGGAGAAACAAACATTACTAAAGAGGCGA

TTGCTTGCAGAGAAACTTAAAGAAGAAGTTATTAATAAGTAATATGAAAAATTAGCAAAACAGAAGCCCAAATTTTCTTAAAAATAAATTATTTAATCCT

TAAACAAAGACTGTTAGTTTCAAGCAAATACTTGCTTTTCTAAATGCAACTGTGAACTGACTATTATTTTAAACAGGTAAAGGCAAGAGGGAAGGCAATT

TAAAAAACGTCTGCAGAAATCCAGGTATGATGGTGCATGCCTATAATCCTAGCACCCAGGATGCTGAATGAAGTAGAAGGATCAGGAGAACTCCTGGTCC

TCTCCAGTGTCAGAGCAAATTGGAGGCCAGCCTAGTTTACATGATGAGTCTGTCTCAAATAACCACAATAAATAAATTT
Translation
MAAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEV VFDDEEESKLTYTEIHQEYKEL - UNI1802 - VEKLLESYLKEIGINEDQFQEACTS

PLAKTRTSQ - UNI1496 - AILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQERNG GVLPDCLTDGADVVSDLEQEEMKILREVLR RKSKEEY

DQEEERKRKKQ SSEAKMEELPVYTSEAEKMSNSQGDGEHFVQPPSE EVKVHFANQSVQPLARKMELLPETSSLTQKGLKIPGLEHASMEGPIA NLSA

LGTEELRQREHYLKQKRDKLLSMRKDTRTKQIQNTEQKGKPTREAE EMTEKPEMTAEEKQTLLKRRLLAEKLKEEVINK

For any suggestions or comments, please send an email to unitrap@crg.es