Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020485 (Supt4h1)
Chromosomal location
Chr 11: 87551053 - 87557116 (+)
Description
suppressor of Ty 4 homolog 1 (S. cerevisiae) Gene [Source:MGI (curated);Acc:Supt4h1-001]
RefSeq_dna
NM_009296 
RefSeq_peptide
NP_033322.1 NP_035639.1 
MGI
MGI:1335090 MGI:107416 
Uniprot/SWISSPROT
P63271 Q9Z199 
Uniprot/SPTREMBL
B2KGH6 
Human Ortholog
ENSG00000213246 (SUPT4H1)
Omim not available
UniTrap UNI32440
Vector Insertion
Chr 11: 87551171 - 87551668
Public Clones (sanger) IST14187C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26459
Vector Insertion
Chr 11: 87551668 - 87551776
Public Clones not available
Private Clones OST116676 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26905
Vector Insertion
Chr 11: 87556297 - 87556298
Public Clones not available
Private Clones OST86936 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093955
Sequence
CTGTTTACTTCCTGCGGCTGGAGGAACCTGTGTTGTCGTATCGGTGAGGATGGCCCTGGAGACGGTACCAAAGGACCTGCGGCATCTGCGGGCTTGTTTG

CTGTGCTCGTTAGTCAAG - UNI26459 - - UNI32440 - ACTATAGACCAGTTCGAATATGATGGGTGTGACAATTGCGATGCATACCTACAAA

TGAAGGGCAACAGAGAGATGGTTTATGACTGCACCAGCTCTTCATTTGATGG - UNI26459 - - UNI26905 - AATCATTGCGATGATGAGTCC

AGAGGACAGCTGGGTCTCCAAGTGGCAGCGAGTCA GTAACTTTAAGCCAGGTGTATATGCTGTGTCCGTCACTGGTCGCCTGCCCCAAG GAATCGTGC

GGGAGCTGAAAAGTCGAGGAGTGGCCTACAAATCCAGAGACACAGCAATAAAGACCTAGCTAGGTGCAGGCCATAGCATCTTGTTCTTCACTTCTGTACT

TGTTTTCTTGTGGAACTAAACCGTGGGACCCCAAAGACTCCCCGCCCTCCATCTCCGAATCAGCAGACTCCACGAAAGCAGCACATCGGCCTTAAGTCAT

CTCACTTTCTCTGCCCACTGGTGAAGTGGGAGTGTCTGGGCGGATTCTCAGAGGCTGTGTCAACAGAGGAAGATGCTGATTTCCCACCTGTGTTCAGGGT

TTTGCCTTTGTCTATGGGCAGGACTTTGGTTCAAATACCAATAAAGCGAGCCTTTGGAAC
Translation
MALETVPKDLRHLRACLLCSLVK - UNI26459 - - UNI32440 - TIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDG - UNI26459 - 

- UNI26905 - GIIAMMSPEDSWVSKWQRVS SNFKPGVYAVSVTGRLPQG GIVRELKSRGVAYKSRDTAIKT
Transcript ENSMUST00000107947
Sequence
CTGTTTACTTCCTGCGGCTGGAGGAACCTGTGTTGTCGTATCGGTGAGGATGGCCCTGGAGACGGTACCAAAGGACCTGCGGCATCTGCGGGCTTGTTTG

CTGTGCTCGTTAGTCAAG - UNI26459 - - UNI32440 - ACTATAGACCAGTTCGAATATGATGGGTGTGACAATTGCGATGCATACCTACAAA

TGAAGGGCAACAGAGAGATGGTTTATGACTGCACCAGCTCTTCATTTGATGG - UNI26459 - GTGCCTTGCTCGGGCTGTTGCTTTGGGGAGCTGC

TGTGGCCCCCTCCAGCAGGGCAGGCTTGGGCTGACGCTTTGTCTTCCTCTCTAG
Translation
MALETVPKDLRHLRACLLCSLVK - UNI26459 - - UNI32440 - TIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDG - UNI26459 - 

GCLARAVALGSCCGPLQQGRLGLTLCLPL
Transcript ENSMUST00000107944
Sequence
CTGTTTACTTCCTGCGGCTGGAGGAACCTGTGTTGTCGTATCGGTGAGGATGGCCCTGGAGACGGTACCAAAGGACCTGCGGCATCTGCGGGCTTGTTTG

CTGTGCTCGTTAGTCAAG - UNI26459 - - UNI32440 - ACTATAGACCAGTTCGAATATGATGGGTGTGACAATTGCGATGCATACCTACAAA

TGAAGGGCAACAGAGAGATGGTTTATGACTGCACCAGCTCTTCATTTGATGG - UNI26459 - CCGTTCAAGGCTGACAATGAATGACGAAGCTGGT

TGTGTTGATGCAGCCTTCAGTCCTAGCTCTCAAGCTGAGCAGGGGACACAAGTGTCGGGTAGCCTTCTGCTGCATCATGAGACGACGCCCCCATCTAAAA

ATTAAAAT - UNI26905 - AATCATTGCGATGATGAGTCCAGAGGACAGCTGGGTCTCCAAGTGGCAGCGAGTCA GTAACTTTAAGCCAGGTGTAT

ATGCTGTGTCCGTCACTGGTCGCCTGCCCCAAG GAATCGTGCGGGAGCTGAAAAGTCGAGGAGTGGCCTACAAATCCAGAGACACAGCAATAAAGACCT

AGCTAGGTGCAGGCCATAGCATCTTGTTCTTCACTTCTGTACTTGTTTTCTTGTGGAACTAAACCGTGGGACCCCAAAGACTCCCCGCCCTCCATCTCCG

AATCAGCAGACTCCACGAAAGCAGCACATCGGCCTTAAGTCATCTCACTTTCTCTGCCCACTGGTGAAGTGGGAGTGTCTGGGCGGATTCTCAGAGGCTG

TGTCAACAGAGGAAGATGCTGATTTCCCACCTGTGTTCAGGGTTTTGCCTTTGTCTATGGGCAGGACTTTGGTTCAAATACCAATAAAGCGAGCCTTTGG

AAC
Translation
 - UNI26459 - - UNI32440 -  - UNI26459 - MTKLVVLMQPSVLALKLSRGHKCRVAFCCIMRRRPHLKIKI - UNI26905 - IIIA

MMSPEDSWVSKWQRVS SNFKPGVYAVSVTGRLPQG GIVRELKSRGVAYKSRDTAIKT

For any suggestions or comments, please send an email to unitrap@crg.es