Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020516 (Rps6kb1)
Chromosomal location
Chr 11: 86316064 - 86358276 (-)
Description
ribosomal protein S6 kinase, polypeptide 1 Gene [Source:MGI (curated);Acc:Rps6kb1-001]
RefSeq_dna
NM_028259 
RefSeq_peptide
NP_001107806.1 NP_082535.1 
UniGene
Mm.394280 
MGI
MGI:1270849 
Uniprot/SWISSPROT
Q8BSK8 
Uniprot/SPTREMBL
O35670 Q3UXD8 Q5SWG1 Q5SWG2 Q6IQZ7 Q9CST0 Q8C3J7 
Human Ortholog
ENSG00000108443 (RPS6KB1)
Omim not available
UniTrap UNI6893
Vector Insertion
Chr 11: 86348963 - 86358067
Public Clones (sanger) BGA391 (baygenomics) P117E03 (ggtc) IST13682B1 (tigm) IST13682D1 (tigm)
Private Clones OST431204 (lexicon) OST370946 (lexicon) OST174137 (lexicon) OST35707 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17469
Vector Insertion
Chr 11: 86347649 - 86348912
Public Clones not available
Private Clones OST442176 (lexicon) OST381230 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25001
Vector Insertion
Chr 11: 86346343 - 86347527
Public Clones not available
Private Clones OST198463 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6165
Vector Insertion
Chr 11: 86333542 - 86346273
Public Clones CSG121 (baygenomics)
Private Clones OST190950 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20547
Vector Insertion
Chr 11: 86320401 - 86325090
Public Clones IST12571B3 (tigm)
Private Clones OST359052 (lexicon)
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30411
Vector Insertion
Chr 11: 86316465 - 86317767
Public Clones CMHD-GT_394B5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020824
Sequence
AGACGCATTGAGCTTAAGCAGCCGGTGATGGCGGCAGCAGCCGTGGAGTCTGCGGCGGGTCCGGGCCCATGAGGCGACGACGGAGGCGGGACGGCTTTTA

CCTAGCGCCTGACTTCCGACACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAAGATGCAGGCTCTGAGGATGAGCTG

GAGGAGGGG - UNI6893 - GGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACT - UNI17469 - TGGCATGGAACATT

GTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTA

TGGAAAG - UNI25001 - GTTTTTCAAGTACGAAAAGTAACAGGAGCAAATACTGGGAAGATATTTGCCATGAAGGTGCTTAAAAAG - UNI6165

 - GCAATGATAGTGAGGAATGCTAAGGACACGGCCCACACGAAAGCAGAGCGGAACATTCTGGAGGAAGTGAAACACCCTTTCATTGTGGACCTGATTT

ATGCCTTTCAGACCGGAGGAAAGCTCTACCTCATCCTCGAGTATCTCAGTG GAGGAGAACTATTTATGCAGTTAGAAAGAGAGGGAATATTCATGGAAG

ACACAGCGTG CTTTTACTTGGCTGAAATCTCCATGGCTTTGGGGCATTTACATCAAAAAGGGATCATCTACAGAGACCTGAAGCCGGAGAACATCATGC

TTAATCACCAAG GTCACGTGAAACTAACAGACTTTGGACTATGCAAAGAATCTATTCATGATGGAACAGTCACGCACACATTTTGTGGAACAATAGAAT

ACAT GGCCCCTGAAATCTTAATGAGAAGCGGCCACAACCGTGCTGTGGATTGGTGGAGTTTGGGAGCATTAATGTATGACATGCTGACTGGAGCA CCT

CCATTCACTGGGGAGAATAGAAAGAAAACAATTGACAAAATCCTCAAATGTAAACTTAATTTGCCTCCCTACCTCACACAAGAAGCTCGAGATCTGCTTA

AAAAG CTGCTGAAAAGAAATGCTGCTTCTCGTCTTGGAGCTGGCCCTGGGGATGCTGGAGAAGTCCAA GCTCATCCTTTTTTCAGACACATTAACTGG

GAAGAACTTCTGGCTCGGAAGGTGGAACCTCCCTTTAAGCCTCTGTTG - UNI20547 - CAATCTGAAGAGGATGTGAGTCAGTTTGATTCAAAGTT

TACACGTCAGACACCTGTTGACAGCCCTGATGACTCCACTCTCAGTGAAAGTGCCAACCAGGTCTTTCTG GGTTTTACATATGTGGCTCCATCTGTACT

TGAAAGTGTGAAAGAAAAGTTTTCATTTGAACCAAAAATCCGATCTCCTAGAAGATTTATTGGTAGTCCACGAACACCTGTCAG - UNI30411 - CC

CAGTCAAATTCTCTCCTGGGGATTTCTGGGGACGAGGTGCTTCAGCCAGCACGGCAAATCCTCAGACCCCTGTGGAATACCCAATGGAAACAAGTGGGAT

AGAGCAGATGGATGTGACAGTGAGCGGGGAAGCATCAGCGCCACTTCCAATCCGACAACCCAACTCCGGGCCGTACAAAAAACAAGCTTTTCCTATGATC

TCCAAACGGCCAGAGCACCTGCGGATGAATCTATGATGAAACAATGCTTTTATTAATGCAAAATCAAAAAGGAAACAAATCCGGGAAGGGGATGTGTGAG

CATCCTGCAATATAAAAACAAGAATAAAATGGCAGTCTCAAAGAGTCAGTGTCATTACCTGGAATGCTTTCGATGGAGGAAAAAATAAACATGGATTTT
Translation
MRRRRRRDGFYLAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELEEG - UNI6893 - GQLNESMDHGGVGPYEL - UNI17469 - LGMEHCEKF

EISETSVNRGPEKIRPECFELLRVLGKGGYGK - UNI25001 - VFQVRKVTGANTGKIFAMKVLKK - UNI6165 - AMIVRNAKDTAHTKAERN

ILEEVKHPFIVDLIYAFQTGGKLYLILEYLSG GGELFMQLEREGIFMEDTAC CFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQG GHVKLTDFGL

CKESIHDGTVTHTFCGTIEYM MAPEILMRSGHNRAVDWWSLGALMYDMLTGA PPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKK LLKRNAASR

LGAGPGDAGEVQ AHPFFRHINWEELLARKVEPPFKPLL - UNI20547 - QSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFL GFTYVAPSVL

ESVKEKFSFEPKIRSPRRFIGSPRTPVS - UNI30411 - SPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTVSGEASAPLPIRQPNSG

PYKKQAFPMISKRPEHLRMNL
Transcript ENSMUST00000108034
Sequence
AGACGCATTGAGCTTAAGCAGCCGGTGATGGCGGCAGCAGCCGTGGAGTCTGCGGCGGGTCCGGGCCCATGAGGCGACGACGGAGGCGGGACGGCTTTTA

CCTAGCGCCTGACTTCCGACACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAAGATGCAGGCTCTGAGGATGAGCTG

GAGGAGGGG - UNI6893 - GGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACT - UNI17469 - TGGCATGGAACATT

GTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTA

TGGAAAG - UNI25001 - GTTTTTCAAGTACGAAAAGTAACAGGAGCAAATACTGGGAAGATATTTGCCATGAAGGTGCTTAAAAAG - UNI6165

 - GCAATGATAGTGAGGAATGCTAAGGACACGGCCCACACGAAAGCAGAGCGGAACATTCTGGAGGAAGTGAAACACCCTTTCATTGTGGACCTGATTT

ATGCCTTTCAGACCGGAGGAAAGCTCTACCTCATCCTCGAGTATCTCAGTG GAGGAGAACTATTTATGCAGTTAGAAAGAGAGGGAATATTCATGGAAG

ACACAGCGTG GCCTTGGGTGGACCGCTCTTCACTGCAGAATTTCCTTGAATTG ACTTTCCAGTTCCCAAGGTGCAGTCTTAGGGAGGTGATAACCCTG

AACATACATCTGTGGATTGATTTTATAGCCAGGATGGGATCTGCCCTCCTATTC GCCTTTTCTAACACAGAAGCTGCATTTAAGAGCCTTAGGGATGAA

GTGCCCCTTTTTGGAGGAGGCTCTCTGAGCCCTGTGGAGGCTGTGGTCCTGCTAGCTGTGAAACTGCCTCAGTCCTCTAGGACACACCCTCCATCCTGGA

GTAATCTGCAGGATTGCAACATTGTTACACAGCCAGTATTGCAGTGCTTTGTGCTTTTCGAATCCAGACAGGGTTGA
Translation
MRRRRRRDGFYLAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELEEG - UNI6893 - GQLNESMDHGGVGPYEL - UNI17469 - LGMEHCEKF

EISETSVNRGPEKIRPECFELLRVLGKGGYGK - UNI25001 - VFQVRKVTGANTGKIFAMKVLKK - UNI6165 - AMIVRNAKDTAHTKAERN

ILEEVKHPFIVDLIYAFQTGGKLYLILEYLSG GGELFMQLEREGIFMEDTAW WPWVDRSSLQNFLEL TFQFPRCSLREVITLNIHLWIDFIARMGSA

LLF AFSNTEAAFKSLRDEVPLFGGGSLSPVEAVVLLAVKLPQSSRTHPPSWSNLQDCNIVTQPVLQCFVLFESRQG
Transcript ENSMUST00000058286
Sequence
AGACGCATTGAGCTTAAGCAGCCGGTGATGGCGGCAGCAGCCGTGGAGTCTGCGGCGGGTCCGGGCCCATGAGGCGACGACGGAGGCGGGACGGCTTTTA

CCTAGCGCCTGACTTCCGACACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAAGATGCAGGCTCTGAGGATGAGCTG

GAGGAGGGG - UNI6893 - GGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACT - UNI17469 - TGGCATGGAACATT

GTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTA

TGGAAAG - UNI25001 - GTTTTTCAAGTACGAAAAGTAACAGGAGCAAATACTGGGAAGATATTTGCCATGAAGGTGCTTAAAAAG - UNI6165

 - GCAATGATAGTGAGGAATGCTAAGGACACGGCCCACACGAAAGCAGAGCGGAACATTCTGGAGGAAGTGAAACACCCTTTCATTGTGGACCTGATTT

ATGCCTTTCAGACCGGAGGAAAGCTCTACCTCATCCTCGAGTATCTCAGTG GAGGAGAACTATTTATGCAGTTAGAAAGAGAGGGAATATTCATGGAAG

ACACAGCGTG GCCTTGGGTGGACCGCTCTTCACTGCAGAATTTCCTTGAATTG ACTTTCCAGTTCCCAAGGTGCAGTCTTAGGGAGGTGATAACCCTG

AACATACATCTGTGGATTGATTTTATAGCCAGGATGGGATCTGCCCTCCTATTC GCCTTTTCTAACACAGAAGCTGCATTTAAGAGCCTTAGGGATGAA

GTGCCCCTTTTTGGAGGAGGCTCTCTGAGCCCTGTGGAGGCTGTGGTCCTGCTAGCTGTGAAACTGCCTCAGTCCTCTAGGACACACCCTCCATCCTGGA

GTAATCTGCAGGATTGCAACATTGTTACACAGCCAGTATTGCAGTGCTTTGTGCTTTTCGAATCCAGACAGGGTTGATTCAGCCCTTTATTCTTTTGAG 

CTTTTACTTGGCTGAAATCTCCATGGCTTTGGGGCATTTACATCAAAAAGGGATCATCTACAGAGACCTGAAGCCGGAGAACATCATGCTTAATCACCAA

GGTGGAGACTTATCGTGAACAATTCTGTAGTAAAGTCAGCTTACCATCTTTCCACATGATGATGGCCATTTTCAAGGCTCCCATGTTTATCTCTGTCTTG

TTACATATATTCCCCCTCAGAATATATCGTATCACAGTACTTTACAGTACTTTAGTATCTAGTATTTTATGATTGAGCTTAAGTAGAGTTAAACATATTA

GCCATTCTTTACAACTTTTAAAAAAAGTTACATATAAAATATTTCGACTCCAAAGCCAATTCAGATGTTGATACTGATTTATGCCATTGTGTTTTAATGA

CAAAAACACAGAAGCAAAACCTGTTTGTTTTCTTGGATATGGTCTTTTTGTACAGCCAGCTGGCATTGAACTTAGGGTCTTCCTGCCTCAGTCTCCCAAG

TGTAGAGCTTACATATGTGTACCACCACCATGTAGCTAAAAGCAAAACTTTTTATAATAAATTTTAACTAATGTTTGAAGAAGAAAAAGACTGAAATTGA

ACTACATTATTTGCTATTGCCCCCATAATAAAATATTCCCTAGGCATAGATTAATCAGAGAAACAAACATTCTGTTTAGCTATCAATATAACAAAACAAG

CATTGGTTATAGCTCCATGCTCCTACAGCTCAATTTCTTCTGCTGTAGTGTGAGCTGGGAAGGCTTTGCAGTTTACTCAAGGAACAAACTAGCAGACCAA

GGCATCTACAAAGTTGTGAGCATTTGCTGATCCTTAGGTCTCCATAGGATGATTTTTGAGGTAGTTAATCAGTGTAAACTCTTACACAGAAAATGGTGAG

GCCTATATAAATGTTACAAATAGTACTTTTTAAGAATTTGTTCGTGAGGGACTGGAGAGATGGGTCAGGGTTAAGAACATCTGCTCATGCAGAGGACCTG

GGTTTAATTCCAGGTGTCTTACAACATCTGAACTTTACTTCCTGGGAACCTGAAACTAGGGTTTGTTGGCACCAGGCACACATGTAGTGTACATATATAC

ACATAGGCAAAACCCTCATACATCTGAAATAAAAGAAAAAAAAAACTCGTTTTAATTGAAAAAAATGATAGAATTGACAAACTGCATTGTTAGAACCATG

TCTGTACTCCTCCCTTCCTATGGCAAACCTGCATGCTGATTCTGAATTCTTTGTTGTTGTTTTTAAGGTATTTAAATTATTTTTCCTGTTATGAGAACTG

AACCCTGTTCTTTGTGCATGCTGCCACCAAGCTATGACCCCCAACCCTTCTGATTTTCAGTTCTAAGACAAAGGATAGAACAAGAGAATGGTGGAATAGC

AAAATTACTTTTTAAATCCATAACTTTGGATATATCATTTGGTTCTATGAGAATAAAAGCTATGGCCAAGTATAGAGGCACACAACCTATAATTCTAGCA

CTGTGGATTGTAAATAAAGAGAATTACTTTTCAAGGTTAGTCTGAGTAGGTAATTGAGTTCCAGGCCAGGTTCTGTCTCCTGCCCAGATCCAGTCTCCAG

AAGGGTTCTGAGGGGCTGGAGAGATGGCTTGTTCTGCTTAGCTATAGACCTGGGATCCCAATACTGCATATTGGCTCACAGCCATTATAACTCCAGGTTC

AGGGTTTCTCAGCCCTCTTATGGCTTTGGCATTAGTACATATGTTGCACTTACATTCATGCAGGCAGAATTACTCATTACACATAAAATAAATTTATTAA

AAATGAGAAAATAAAAAATAAATATAGCCCAGTTTCTTCTTTTGTATCAGAATGTAGTAGATGTTCACAGCTGAATAAATGTAAGTGAGCCATTGCCTTT

TGTCTGAAAGGAACCTTCAGTAATAGGGCCCTTGCTATTGATGAGCCACTGATTAATTAAATGACAGCTGAGAGAAACTTATCTGAAATAATCTTTGTAT

AGGGTAGAATTCCACCTTCTGGAACAGAAATGGTTATCCTATGCAAATTTTAGTTCTTTTCCTTCACTGGCAGCTTTTGGCAGTAAATAATTGAATTTGT

TTCTGCTAACTGATAGCATTTGGCATAGTAAGCCATATGGTAACTTTCTGAGACTGTTATAAGAACTCTTAAGTACACTGTGAAGAAACAATACAGTTGA

AGTATGCTG
Translation
MRRRRRRDGFYLAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELEEG - UNI6893 - GQLNESMDHGGVGPYEL - UNI17469 - LGMEHCEKF

EISETSVNRGPEKIRPECFELLRVLGKGGYGK - UNI25001 - VFQVRKVTGANTGKIFAMKVLKK - UNI6165 - AMIVRNAKDTAHTKAERN

ILEEVKHPFIVDLIYAFQTGGKLYLILEYLSG GGELFMQLEREGIFMEDTAW WPWVDRSSLQNFLEL TFQFPRCSLREVITLNIHLWIDFIARMGSA

LLF AFSNTEAAFKSLRDEVPLFGGGSLSPVEAVVLLAVKLPQSSRTHPPSWSNLQDCNIVTQPVLQCFVLFESRQG 

For any suggestions or comments, please send an email to unitrap@crg.es