Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020546 (Stxbp4)
Chromosomal location
Chr 11: 90341250 - 90499398 (-)
Description
syntaxin binding protein 4 Gene [Source:MGI (curated);Acc:Stxbp4-001]
RefSeq_dna
NM_011505 
RefSeq_peptide
NP_035635.1 
UniGene
Mm.473537 Mm.405766 
MGI
MGI:1342296 
Uniprot/SWISSPROT
Q9WV89 
Uniprot/SPTREMBL
B1ATH0 
Human Ortholog
ENSG00000166263 (STXBP4)
Omim not available
UniTrap UNI31861
Vector Insertion
Chr 11: 90483505 - 90499380
Public Clones IST13549D1 (tigm) IST14308B10 (tigm) IST14890B11 (tigm) IST14295D12 (tigm)
IST13200C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24371
Vector Insertion
Chr 11: 90480630 - 90482968
Public Clones not available
Private Clones OST223227 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8451
Vector Insertion
Chr 11: 90433102 - 90436563
Public Clones RRQ032 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020858
Sequence
CCAGATTCCACAGTTAGCAGTGGCGCTACGGAGGCCGGGTGGCCCGAAGAGG - UNI31861 - GAAACCAGTGAAATGGAGTAGTATGCACTAGAGC

CATACAGAATCTGCAGGAAGACCCTCGGGGGAGTCG - UNI31861 - CCTGAGGATAAAAAGAATATTTAGACTCTCCAAGTTCTTCCTTTACATAG

CTGCTAAATCCAAGGAAACTGTGTCGAAAGCATGAGTGATGGTACAGCTTCTGCCCGATCATCCAGCCCACTTGACAG - UNI24371 - GGATCCTG

CCTTTCGGGTGATTACAGTTACTAAGGAAACAGGTCTAGGTCTGAAGATCCTAGGCGGAATTAACAGGAATGAAGGACCGCTGGTGTATATTCACGAAGT

CATTCCTGGAGGTGACTGTTACAAG GATGGACGTTTGAAGCCAGGAGATCAACTTGTCTCAATAAACAAGGAATCTATGATTGGTGTATCATTTGAAGA

AGCAAAAAGCATAATTACCAGAGCCAAGTTGAG GTCAGAATCTCCCTGGGAGATAGCATTCATCAGACAAAAGTCTTACTGTGGCCATCCAGGAAATAT

TTGCTGTCCATCCCCACAAGTGTCAGAAGACTGTGGACCTCAAACCTCAACATTTACTCTTCTTTCCTCTCCCTCTGAAACACTACTTCCAAAGACTTCA

TCCACTCCCCAGACTCAGGACTCCACTTTCCCTTCTTGTAAAGCAATTCAG ACAAAACCTGAACACGATAAAACAGAACATAGTCCAATTACTTCTTTG

GACAACAGCCCTGCAGATACATCTAATGCAG ACATTGCTCCAGCCTGGACTGATGATGATTCTGGACCACAAGGAAAGATTTCCCTAAATCCTTCTGTT

CGCCTTAAGGCAGAGAAACTGGAAATG GCTCTCAATTACCTCGGTATACAGCCAACAAAGGAACAACGTGAAGCCCTGAGAGAGCAAGTCCAGGCCGAC

TCAAAGGGGACTGTGTCTTTTGGAG ATTTCGTCCAGGTTGCCAGAAGTTTGTTTTGCTTGCAGTTGGATGAAGTAAATGTTGGTGTCCATGAAATCCCC

AGCATCTTAGACTCACAG CTTCTCCCCTGTGATTCTCTAGAAGCAGATGAAGTGGGAAAACTTAGACAAGAAAGAAACGCTGCTCTAGAGGAACGGAAT

GTGCTTAAG - UNI8451 - GAGAAGTTACTGGAATCAGAAAAGCACAGGAAACAATTGATAGAAGAACTCCAGAATGTGAAGCAG GAAGCCAAAGC

TGTAGCTGAGGAAACCCGAGCTCTGCGAAGCCGGATTCATCTCGCAGAAGCTGCACAGCGGCAGGCACACGGGATGGAAATGGATTATGAAGAGGTGATC

CGTCTGCTAGAGGCTGAGGTCTCAGAACTAAAGGCTCAGCTCGCTGATTATTCTGACCAAAATAAA GAAAGTGTCCAGGACTTGAGAAAAAGAGTCACC

GTTCTTGACTGCCAATTGCGAAAATCAGAAATGGCTCGGAAAGCATTCAAGGCGTCCACTGAAAGGCTCCTTGGTTTCATAGAG GCTATTCAAGAAGTT

CTTTTGGATAGTTCTGCTCCTTTATCAACTTTAAG TGAAAGAAGAGCTGTGCTCGCATCTCAGACTTCGCTTCCACTGCTGGCAAGGAACGGACGCAGC

TTCCCAGCAACCCTGCTTCTGGAATCCAAGGAGCTTGTCAGATCTGTCCGTGCCATACTTGATATGGACT GCTTACCTTACGGGTGGGAGGAAGCTTAC

ACAGCAGATGGAATCAAGTACTTCATCAA CCACGTGACACAGACCACGTCCTGGATCCACCCCGTGATGAGCGCCCTGAACCTGTCCTGTGCAGAGGAG

AGTGAAGAGGACTGTCCCAGAGAGCTAACAGACCCGAAAAGCTGATGGGTTTCCATGGGAAATGGAGCAGCAGAGTCCTCTGGCTTCTCAGTCCATGTCC

ACAACCAGACACAAGCCACCACACCCCGAGACACAGGAATCCAGCACGTGCACCAGGCAGGGTGTCAAGTCGCAAGTGTGGTATTTTCGTGTACATGTTA

AAGATCAGTTGCCACTACAGTAGTTTTTTTGGAAATAATCTAGTTGCATTTATTGAAGTCATTTATAGTCAGATTTTACATGCATAAACCTCTTTATAAT

TAGATCTTTATAACTCAGTATGTTAGCTCATTGTTTGGTATGAGATACAATGGTTTGTATATCAACACTTCATATTGAAAAGTTATACGAACATAGCAAA

CTCCTTTTTATAACTCTCCCTCCCAACCCACAGCTTAGGAAAAATGTTCTGAGAAAGCGAGGGGAGGCTGCCTCACAGCTGTCCCACTAGCTGCTGACTA

CAACTTGTACCAAATAGGACACCACCTAACTTATATTATTAGGAGACATCTATCATTTATAAAGTGCTTTCAAGCCGGGCAGTGGTGGTGCACGCCTTTA

ATCCCAGCACTTGGGAGGTAGAGGCAGGCGGATTTCTGAGTTCGAGGCCAGCCTGGCCTACAAAGTGAGTTCCAGGACAGCCAGGGCTACACAGAGAAAC

CCTGTCTCG
Translation
 - UNI31861 -  - UNI31861 - MSDGTASARSSSPLDR - UNI24371 - RDPAFRVITVTKETGLGLKILGGINRNEGPLVYIHEVIPGGD

CYK DGRLKPGDQLVSINKESMIGVSFEEAKSIITRAKLR RSESPWEIAFIRQKSYCGHPGNICCPSPQVSEDCGPQTSTFTLLSSPSETLLPKTSSTP

QTQDSTFPSCKAIQ TKPEHDKTEHSPITSLDNSPADTSNAD DIAPAWTDDDSGPQGKISLNPSVRLKAEKLEM ALNYLGIQPTKEQREALREQVQAD

SKGTVSFGD DFVQVARSLFCLQLDEVNVGVHEIPSILDSQ LLPCDSLEADEVGKLRQERNAALEERNVLK - UNI8451 - EKLLESEKHRKQLIE

ELQNVKQ EAKAVAEETRALRSRIHLAEAAQRQAHGMEMDYEEVIRLLEAEVSELKAQLADYSDQNK ESVQDLRKRVTVLDCQLRKSEMARKAFKASTE

RLLGFIE AIQEVLLDSSAPLSTLS SERRAVLASQTSLPLLARNGRSFPATLLLESKELVRSVRAILDMDC CLPYGWEEAYTADGIKYFIN NHVTQT

TSWIHPVMSALNLSCAEESEEDCPRELTDPKS
Transcript ENSMUST00000107875
Sequence
GTGGCGCTACGGAGGCCGGGTGGCCCGAAGAGG - UNI31861 - GAAACCAGTGAAATGGAGTAGTATGCACTAGAGCCATACAGAATCTGCAGGAA

GACCCTCGGGGGAGTCG - UNI31861 - CCTGAGGATAAAAAGAATATTTAGACTCTCCAAGTTCTTCCTTTACATAGCTGCTAAATCCAAGGAAAC

TGTGTCGAAAGCATGAGTGATGGTACAGCTTCTGCCCGATCATCCAGCCCACTTGACAG - UNI24371 - GGATCCTGCCTTTCGGGTGATTACAGT

TACTAAGGAAACAGGTCTAGGTCTGAAGATCCTAGGCGGAATTAACAGGAATGAAGGACCGCTGGTGTATATTCACGAAGTCATTCCTGGAGGTGACTGT

TACAAG GATGGACGTTTGAAGCCAGGAGATCAACTTGTCTCAATAAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAAGCATAATTACC

AGAGCCAAGTTGAG GTCAGAATCTCCCTGGGAGATAGCATTCATCAGACAAAAGTCTTACTGTGGCCATCCAGGAAATATTTGCTGTCCATCCCCACAA

GTGTCAGAAGACTGTGGACCTCAAACCTCAACATTTACTCTTCTTTCCTCTCCCTCTGAAACACTACTTCCAAAGACTTCATCCACTCCCCAGACTCAGG

ACTCCACTTTCCCTTCTTGTAAAGCAATTCAG ACAAAACCTGAACACGATAAAACAGAACATAGTCCAATTACTTCTTTGGACAACAGCCCTGCAGATA

CATCTAATGCAG ACATTGCTCCAGCCTGGACTGATGATGATTCTGGACCACAAGGAAAGATTTCCCTAAATCCTTCTGTTCGCCTTAAGGCAGAGAAAC

TGGAAATGGTAAATCCCTTAAAAAAAAATCATTTTCTTCACAAGACAGCAGGGAAGAACTGCCTTGTTCTTGGAGAGGAGGACATTGGAGAGTCATTGGT

TTCTTGAAGTAGCTTGTTTAATTAAGTGAGTGACAGTTTGGGTTTCAATTATTTAATAACATTTAGATTTAGAAGTTCATAGTACTTCACTAGTATAAAA

CAAACAAAGTCTTTGGCTCTAAGCTAACATGGAAATGAGTTTCTTTCCCTTTGGCTAGAGTGATAGCTCAGTGGGTAAACGTGCTAGCCATGGAAACATA

AGAAGCTTACTTAAGAACCCCCGGTCCTACAGGACTCATATTTTAAAAAGACAGGCTTGTGTGGAAGCACAGATAGGCAGCTCCCTGGGCCTCGATGCCG

GTTAGTTTGTACTGCTGGGCTTTTGTGGTGACTCCACACAGGCTGATACTTTCTGGGAAGAAGGCGTCAACTGGAAAAGAAAAGGATAACGCCTTCTTCA

GGTTGCCTTGTAGGCAAGTTTGTTAGGCATTTTCTTGATTAAGGCTTGATGTGGGAGGGCCCAGCCTACAGTGGGTAGTGCCAACCCTAGGTAATTGGTC

CTGGGTTGTATGAGAAAGCAGGCTGAGCAAGCCCTGGGCAGCAAGCCAGTAAGCGACACCCTTCATGGCCTCTGCTCCACCTCCTGCTTTCAGCTTTCTG

TCTGGAATTCCTGCCCTGACTTCCTTCCATGATAGAGTGCGACCAGAGGGTTGTATATAGAATAAAGTCTTTCTTCTTGAGTTGCTTTTGGTCATGGTAT

TTATAG
Translation
 - UNI31861 -  - UNI31861 - MSDGTASARSSSPLDR - UNI24371 - RDPAFRVITVTKETGLGLKILGGINRNEGPLVYIHEVIPGGD

CYK DGRLKPGDQLVSINKESMIGVSFEEAKSIITRAKLR RSESPWEIAFIRQKSYCGHPGNICCPSPQVSEDCGPQTSTFTLLSSPSETLLPKTSSTP

QTQDSTFPSCKAIQ TKPEHDKTEHSPITSLDNSPADTSNAD DIAPAWTDDDSGPQGKISLNPSVRLKAEKLEMVNPLKKNHFLHKTAGKNCLVLGEED

IGESLVS
Transcript ENSMUST00000107873
Sequence
CCAGATTCCACAGTTAGCAGTGGCGCTACGGAGGCCGGGTGGCCCGAAGAGG - UNI31861 - GAAACCAGTGAAATGGAGTAGTATGCACTAGAGC

CATACAGAATCTGCAGGAAGACCCTCGGGGGAGTCG - UNI31861 - CCTGAGGATAAAAAGAATATTTAGACTCTCCAAGTTCTTCCTTTACATAG

CTGCTAAATCCAAGGAAACTGTGTCGAAAGCATGAGTGATGGTACAGCTTCTGCCCGATCATCCAGCCCACTTGACAG - UNI24371 - GGATCCTG

CCTTTCGGGTGATTACAGTTACTAAGGAAACAGGTCTAGGTCTGAAGATCCTAGGCGGAATTAACAGGAATGAAGGACCGCTGGTGTATATTCACGAAGT

CATTCCTGGAGGTGACTGTTACAAG GATGGACGTTTGAAGCCAGGAGATCAACTTGTCTCAATAAACAAGGAATCTATGATTGGTGTATCATTTGAAGA

AGCAAAAAGCATAATTACCAGAGCCAAGTTGAG GTCAGAATCTCCCTGGGAGATAGCATTCATCAGACAAAAGTCTTACTGTGGCCATCCAGGAAATAT

TTGCTGTCCATCCCCACAAGTGTCAGAAGACTGTGGACCTCAAACCTCAACATTTACTCTTCTTTCCTCTCCCTCTGAAACACTACTTCCAAAGACTTCA

TCCACTCCCCAGACTCAGGACTCCACTTTCCCTTCTTGTAAAGCAATTCAG ACAAAACCTGAACACGATAAAACAGAACATAGTCCAATTACTTCTTTG

GACAACAGCCCTGCAGATACATCTAAT GCAGCTCATATGGAAAGAAAAAAAAGACATGAATCAAGTGGCCAGTCTAAGATGTGGCATTGGAGTTGCTCC

ATGATGAAAGTTGAGGTCTTTATTCCTTGA
Translation
 - UNI31861 -  - UNI31861 - MSDGTASARSSSPLDR - UNI24371 - RDPAFRVITVTKETGLGLKILGGINRNEGPLVYIHEVIPGGD

CYK DGRLKPGDQLVSINKESMIGVSFEEAKSIITRAKLR RSESPWEIAFIRQKSYCGHPGNICCPSPQVSEDCGPQTSTFTLLSSPSETLLPKTSSTP

QTQDSTFPSCKAIQ TKPEHDKTEHSPITSLDNSPADTSN AAHMERKKRHESSGQSKMWHWSCSMMKVEVFIP
Transcript ENSMUST00000107872
Sequence
CACAGTTAGCAGTGGCGCTACGGAGGCCGGGTGGCCCGAAGAGG - UNI31861 - GAAACCAGTGAAATGGAGTAGTATGCACTAGAGCCATACAGA

ATCTGCAGGAAGACCCTCGGGGGAGTCG - UNI31861 - CCTGAGGATAAAAAGAATATTTAGACTCTCCAAGTTCTTCCTTTACATAGCTGCTAAA

TCCAAGGAAACTGTGTCGAAAGCATGAGTGATGGTACAGCTTCTGCCCGATCATCCAGCCCACTTGACAG - UNI24371 - GGATCCTGCCTTTCGG

GTGATTACAGTTACTAAGGAAACAGGTCTAGGTCTGAAGATCCTAGGCGGAATTAACAGGAATGAAGGACCGCTGGTGTATATTCACGAAGTCATTCCTG

GAGGTGACTGTTACAAG GATGGACGTTTGAAGCCAGGAGATCAACTTGTCTCAATAAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAA

GCATAATTACCAGAGCCAAGTTGAG GTCAGAATCTCCCTGGGAGATAGCATTCATCAGACAAAAGTCTTACTGTGGCCATCCAGGAAATATTTGCTGTC

CATCCCCACAAGTGTCAGAAGACTGTGGACCTCAAACCTCAACATTTACTCTTCTTTCCTCTCCCTCTGAAACACTACTTCCAAAGACTTCATCCACTCC

CCAGACTCAGGACTCCACTTTCCCTTCTTGTAAAGCAATTCAG ACAAAACCTGAACACGATAAAACAGAACATAGTCCAATTACTTCTTTGGACAACAG

CCCTGCAGATACATCTAATGCAG CTCATATGGAAAGAAAAAAAAGACATGAATCAAGTGGCCAGTCTAAGATGTGGCATTGGAGTTGCTCCATGATGAA

AGTTGAGGTCTTTATTCCTTGATTATGTTGTAAAACATCAGTTATATAATGTGTTTAATACAGTTTCAGTTTTTTAAGCAACCAAACATCCCCTTAGCCA

CTTATTTAGGATACATTTGCTACATGTTATCCAGTTAGCAGCAAACACAGCACAGCAGGCAGTTAAGAGAGACTTAGGATCTTTCTGTGAGTTATTTAAT

ATTATAGTAAAATAAATCAAGCGGGTAACAGCCTCATTTCTCAAATCAGAAAGCTTGTGAGTACATTTTTCATATGTAAGCACACATGCATGTATTTTAA

AATGTGCACAAACAGTATCCAGACATGTACAATGTAGACCAAGGGGAGAGGGAGGGAGGAACTCTATTCCGTGGGAACAGCCTTTGATATGCATGTGGTG

CAGGAGAGCACAGAGCAGGCTGGGAGTCTCTAATCCTTCATCCTGTTTTCTTAGCTCAGTAACCCTGAGAAGGTTGCTCCAAGGGGAAGTTACAACTAAA

GATCACAGGTACCAAGCCCTTGGCATTATGATTGGTACCTGGCATATGCTCAGCAGTATTTTTATTATTAATCATATTACAGAAATTTAAGCTAGCATGT

ATTTTTGATAACACTCTGGCACAAGAGCCTTGACTAAAAGCAGAAGTGAGTGCTTCTTCCATGGGAGTCAAGTTTGTGTCCTCCTTCAACCTCCAAAACG

AGGGAAGAGTGAAGGACTCAGCGGCATGCAAAGGACAATTCAGAAACATCAGCTTCTCAAAAATGAGACATGCTCTAAATCTTAAAGGAGGCAGGCGGGA

AACCATCCTAATTTAAGGAAGTGCCATGGACCAGAGCACAGAGCTTAGATAAGTGACGTGCGAGAGACCCTCTGCAGCAAGTCTGATGCCAGCGTAGATC

TGGCAATTGTAAGTAAGGGGACACTTGCACCAGTGATTAGAAGCTAATATGCTTGATTTTGGAATAGGAAAGTAACTATTGAAAGTCATTTATAAATATT

AAAATATTAACAATATTTTTCTAGGATAGAAATAACATTAACTCAGCTCCACTTTTTATTTCTACATACATATAGTAGGCAAGATATTACTGGTTGGATT

ATTATACAGGAAGGGAGGCAGCAAACCCTCACAACTGTCTCTAGATAACTTGCACGTGTTATGATTTTCCCACATTAGCCTATTAAGTATCACCTTCTAG

ACTCCTTTATTCCGTGTTCACATGCGTTAGTTGTCTCATTAGTGTCACCTGACAAAGGCAATGTAGGGGAGGAGAGATTATTTGGGTTCACAGTTTCAGA

TGGAACAGTGAGTCTGTTATGTTGGGAAAGACATGGATGAGCAACTATACAACTGTGGGATCCTGTGGCGAAGCTTTCCACATAGTTTCAGTACCAGGTT

CCAGATTACAGATTAGACTGAAAAGAGAAGGGAATGTAAACCATCCAAGACCCAGCCCTCCTGGGTCCCCAGGCTCAGTTGTGGGCACATCCCACACACA

TCCCACAGTTGATGTAACTTCTGTAACCTCCCCCAGTAATACCAGCAGCTGTGGACCTAGTGTTTAAGTTATGAGCCAGTTGGAATAGTTCTCATCGAAT

CATTGCAGTGTTTACTTTTAAAATGTAAACAAGTTTTAATATTAACTTCAGTTACAATAAACATAAGATGTCTCT
Translation
 - UNI31861 -  - UNI31861 - MSDGTASARSSSPLDR - UNI24371 - RDPAFRVITVTKETGLGLKILGGINRNEGPLVYIHEVIPGGD

CYK DGRLKPGDQLVSINKESMIGVSFEEAKSIITRAKLR RSESPWEIAFIRQKSYCGHPGNICCPSPQVSEDCGPQTSTFTLLSSPSETLLPKTSSTP

QTQDSTFPSCKAIQ TKPEHDKTEHSPITSLDNSPADTSNAA AHMERKKRHESSGQSKMWHWSCSMMKVEVFIP

For any suggestions or comments, please send an email to unitrap@crg.es