Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020623 (Map2k6)
Chromosomal location
Chr 11: 110260436 - 110386836 (+)
Description
mitogen-activated protein kinase kinase 6 Gene [Source:MGI (curated);Acc:Map2k6-003]
RefSeq_dna
NM_011943 
RefSeq_peptide
NP_036073.1 
UniGene
Mm.363360 Mm.14487 Mm.474817 
MGI
MGI:1346870 
Uniprot/SWISSPROT
P70236 
Uniprot/SPTREMBL
A2AGS2 P70273 Q8C371 Q3UU57 Q543Z5 Q60521 Q8BP44 
Human Ortholog
ENSG00000108984 (MAP2K6)
Omim not available
UniTrap UNI5079
Vector Insertion
Chr 11: 110260740 - 110343852
Public Clones CSI582 (baygenomics) CSH118 (baygenomics) YTC586 (baygenomics) FHCRC-GT-S20-7C1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8944
Vector Insertion
Chr 11: 110360837 - 110368019
Public Clones RRE185 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100260
Sequence
AGTTCCAAGTTTGGAGCTTTTAGCTGCCAGCCCTGGCCCATCATGTAGCTGCAGCACAGCCTTCCCTAACGTTGCAACTGGGGGAAAAATCACTTTCTAG

ACTGTTTTGCAAGGTGTGCAATTCCACCTTGACTCCCTGAAAGTCCATCTGCTGCATCGGTCAAGAGAAACTCCACTTGCATGAAGATTGCACGCCTGCA

GCTTGCATCTTTGTTGCAAAACTAGCTACAGAAGAGAAGCAAGGCAAAGTCTTTTGTGCTCCCCTCCCCCATCAAAGGAAAGGGGAAAATGTCTCAGTCG

AAAG - UNI5079 - GCAAGAAGCGAAACCCGGGCCTTAAGATTCCAAAAGAAGCGTTTGAACAGCCTCAGACCAGTTCCAC GCCGCCTCGGGATTT

AGACTCCAAGGCTTGCATATCTATTGGAAACCAG AACTTTGAGGTGAAGGCAGATGACCTGGAGCCGATAGTGGAGCTGGGACGAGGTGCGTACGGGGT

GGTGGAGAAGATGCGTCACGTGCCCAGCGGGCAGATCATGGCAGTGAAG CGGATACGGGCCACAGTTAATAGCCAGGAACAGAAACGGCTGCTGATGGA

TTTGGATGTCTCCATGAGGACGGTGGACTGTCCATTCACCGTGACCTTCTACGGTGCACTCTTCCGGGAG GGCGACGTGTGGATCTGCATGGAGCTCAT

GGATACGTCACTAGATAAATTCTACAAACAAGTTATTGATAAAGGCCAAACAATTCCAGAGGATATCTTAGGAAAGATAGCAGTTTCT ATTGTAAAAGC

GTTAGAACATTTACACAGTAAGCTGTCTGTTATCCATCGAG ACGTCAAGCCTTCTAATGTGCTCATTAACACACTGGGCCAGGTGAAGATGTGTGACTT

TGGAATCAGTGGCTACCTGGTCGACTCTGTTGCTAAAACGATCGATGCCGGTTGCAAACCATACATGGCT CCTGAACGAATAAATCCAGAGCTCAACCA

GAAGGGGTACAGTGTGAAGTCTGACATTTGGAGCCTGGGCATCACCATG ATCGAGCTGGCCATCCTTCGGTTTCCTTATGATTCTTGGGGAACGCCCTT

CCAGCAGCTAAAGCAGGTGGTCGAAGAGCCCTCTCCTCAGCTCCCAGCAGACAAGTTCTCCGCGGACTTTGTTGACTTTACCTCACAGTG - UNI8944

 - AGGAGCGGAATGAGATGGACGCATGTGCTCAGCTTTCTGTCTCCTTTTTCTTCACTCTGACCCAGGCCATGGAAAGGTACTACCCACGTAGCAGGTA

TGTTTCCCCACCTCAGGTAATCTATGCTAGACAATCCCTTTTAGATCCAGGCAGGGTTGACTGGATCACTGAGCATCACTGAGGGAGGGCATAGTCAAGC

TTAAGGTTTTCAGGCATCCTCTTCCAAGGCTCTTATTTAATTCCTTCCTCCATAGCTATTAACACCTTCGTAGTAAGAACTCTTCAGATCTCAGACCACA

TCTGAAGGGGGTAAACACCTTTCTTCCATATCCATGTCTCATACTGTCTGGTATTAGTTTGCTCCATCAGAATCATTTCCTCCTCACACAGCATGGAGAA

AGGCGGCTAGCTTCCTGAAGCTCCTATCTTTTTTATTTTAATTTTATTTTTTTTATTGGTCCTGTTTATCTACAGGCACATTGAAAATCCCACAGAAGTT

TATCACGATGTCTGGCTATCTGGCACTACTGTGCAGATGCTGGACTCAGCTGTATGACTGGCCTGGTGTCTCTCCTGCACTTGCTATCCAATGGTTGGAG

TAAGTCGTTCGTGGATGGCTTCATTCATTGCCGAGTGTCTAGATTTGGATGGCTGTGGTATCTGGGAGCTAATTTATCACTTTCTCTCTTACCATATGGT

GGCCAGCTTGGAGTCTTCACAGACTTTCTTCTACCTTGGGATAATCAGAATTCTCCCGGGACTGGAAGACTTCCTTGGATATTAGCTATCTAGAAGGACC

AGGTAGAAGCATCAAATAAGTTACGATGTGAATATTAGAAGCGTATTTTAGAGGAGTAAGTCTTTGAAAACTGACTACCATGCTTGATGAATGCAACATA

GTGAAAATAAACCAGTAAACTT
Translation
MSQSKG - UNI5079 - GKKRNPGLKIPKEAFEQPQTSST TPPRDLDSKACISIGNQ NFEVKADDLEPIVELGRGAYGVVEKMRHVPSGQIMAVK 

RIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFRE GDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVS IVKALEHLHSKLSVIHRD 

DVKPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMA PERINPELNQKGYSVKSDIWSLGITM IELAILRFPYDSWGTPFQQLKQVVEEPSP

QLPADKFSADFVDFTSQ - UNI8944 - Q
Transcript ENSMUST00000020949
Sequence
AGTTCCAAGTTTGGAGCTTTTAGCTGCCAGCCCTGGCCCATCATGTAGCTGCAGCACAGCCTTCCCTAACGTTGCAACTGGGGGAAAAATCACTTTCTAG

ACTGTTTTGCAAGGTGTGCAATTCCACCTTGACTCCCTGAAAGTCCATCTGCTGCATCGGTCAAGAGAAACTCCACTTGCATGAAGATTGCACGCCTGCA

GCTTGCATCTTTGTTGCAAAACTAGCTACAGAAGAGAAGCAAGGCAAAGTCTTTTGTGCTCCCCTCCCCCATCAAAGGAAAGGGGAAAATGTCTCAGTCG

AAAG - UNI5079 - GCAAGAAGCGAAACCCGGGCCTTAAGATTCCAAAAGAAGCGTTTGAACAGCCTCAGACCAGTTCCAC GCCGCCTCGGGATTT

AGACTCCAAGGCTTGCATATCTATTGGAAACCAG AACTTTGAGGTGAAGGCAGATGACCTGGAGCCGATAGTGGAGCTGGGACGAGGTGCGTACGGGGT

GGTGGAGAAGATGCGTCACGTGCCCAGCGGGCAGATCATGGCAGTGAAG CGGATACGGGCCACAGTTAATAGCCAGGAACAGAAACGGCTGCTGATGGA

TTTGGATGTCTCCATGAGGACGGTGGACTGTCCATTCACCGTGACCTTCTACGGTGCACTCTTCCGGGAG GGCGACGTGTGGATCTGCATGGAGCTCAT

GGATACGTCACTAGATAAATTCTACAAACAAGTTATTGATAAAGGCCAAACAATTCCAGAGGATATCTTAGGAAAGATAGCAGTTTCT ATTGTAAAAGC

GTTAGAACATTTACACAGTAAGCTGTCTGTTATCCATCGAG ACGTCAAGCCTTCTAATGTGCTCATTAACACACTGGGCCAGGTGAAGATGTGTGACTT

TGGAATCAGTGGCTACCTGGTCGACTCTGTTGCTAAAACGATCGATGCCGGTTGCAAACCATACATGGCT CCTGAACGAATAAATCCAGAGCTCAACCA

GAAGGGGTACAGTGTGAAGTCTGACATTTGGAGCCTGGGCATCACCATG ATCGAGCTGGCCATCCTTCGGTTTCCTTATGATTCTTGGGGAACGCCCTT

CCAGCAGCTAAAGCAGGTGGTCGAAGAGCCCTCTCCTCAGCTCCCAGCAGACAAGTTCTCCGCGGACTTTGTTGACTTTACCTCACAGTG - UNI8944

 - CTTGAAGAAAAATTCCAAAGAACGGCCCACATATCCAGAGCTTATG CAACATCCATTTTTCACCGTACATGAATCCAAAGCAGCAGACGTGGCATC

TTTTGTAAAACTGATACTTGGGGACTAAAAAGCCATGGACTTAACTGGTCGACCCTACTGTGGATTGGTGGGTTTACAGGGTGAAGAAAGTTCACTACAG

AGCCAACAGAAAGTCATCTTGAGGTCATTGAACCCTGCCTTTCTGAGGGGTTTCCTCTCCCCGTTTTTCTTTTTCCTCTCCAAAGGGGGCCTTGGAATCT

CTAGCGTAGGCTGAACTCTCTAGATGGATGAAATACAACAAAGGCTTAGGACTTGAAATGGTGATTAAATATTTAATGGCAAGTCATACGGGTGGGTCCT

CGAGCTTCTCAGATCTCTCGTGTTCTTTACGAAATGAATGCAATTGGCCCTGGTAACAAGGTGCTACAGTAGTGAAGAGATTGTGAAGTAGATTTGTAGC

GTATCCCACTTATTATTTTAATATTTATGTTTCAGTGCTTGGTTGGAAATATTCCATTTTATGCAAGAAGGGAGATACAGAGACAGGGCTGACTCGGCAG

TATTTATAGGGCTTTTATTTTTTTTGAGTTCAATCATGTCTGTGGTCCAGAGGAAGTTATTTAATATGCATTTTTAAGGATATTATAAAAATCTCCAGCA

AAGGGGCTCTTCCTGTACAGTGTGGCTTGCAGCTCTCATGGCTGCTGCTCCCGACTGTCAACTCAACCGTGGCTGATCATCGCATCGTTTGAATGAACTG

TCAAAGTTAATGTCCCCCCGCCTCCCTCCCCCAACTTTGGAAACCATGAAAGTCACTTGTATCACGGCTCAAAGAGTAAAAAAATACAATGGTTCTCTT
Translation
MSQSKG - UNI5079 - GKKRNPGLKIPKEAFEQPQTSST TPPRDLDSKACISIGNQ NFEVKADDLEPIVELGRGAYGVVEKMRHVPSGQIMAVK 

RIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFRE GDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVS IVKALEHLHSKLSVIHRD 

DVKPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMA PERINPELNQKGYSVKSDIWSLGITM IELAILRFPYDSWGTPFQQLKQVVEEPSP

QLPADKFSADFVDFTSQC - UNI8944 - CLKKNSKERPTYPELM QHPFFTVHESKAADVASFVKLILGD

For any suggestions or comments, please send an email to unitrap@crg.es