Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020627 (Klhl29)
Chromosomal location
Chr 12: 5085903 - 5382488 (-)
Description
kelch-like 29 (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:2683857]
UniGene
Mm.152443 Mm.390459 Mm.395298 
MGI
MGI:2683857 
Uniprot/SWISSPROT
Q80T74 
Uniprot/SPTREMBL
A6H646 
Human Ortholog
ENSG00000119771 (KBTBD9)
Omim not available
UniTrap UNI27756
Vector Insertion
Chr 12: 5298251 - 5381907
Public Clones not available
Private Clones OST50240 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32962
Vector Insertion
Chr 12: 5147372 - 5217068
Public Clones IST14417A3 (tigm) IST14940A4 (tigm) IST14221F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36358
Vector Insertion
Chr 12: 5109494 - 5144742
Public Clones IST14866F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020958
Sequence
GGTCCCCGCGCCGCGGCCGCGCCAATCCCCGCGCCGCCGCCGCCGTCGCCGCTGTCCCTGCCACCGCCGATCTAGCAGCAGCTCTAACCCCGGCTCCGGC

TACCCAGCGCACGTCCGCAGCCCAGGTCATTGGCGAGCCTAAGCTCAGCCCCCTCCCGGAGCCCGAGCCCGGAGCCCGGCGCCCGGAGCCAGCCCCAGCC

CCGCGGCCGCCGCGGCTGCGGGGAGAGGGCGGGGGCGATGCTGCCGGAGCCGCCGCCGCTGCCGCCGCCTCGATGAGAGCCGCGCCGCACCGCGCATAGC

CGCGCAGGCTGACAGGCAGAAAGACTGACTTCCCTCTCCCGGGCATCCTCCCTGGGCTGCCGGGAGGCGGCGGCGGAGGAGGAGGAGGAGGGAAAAGGGG

AGAAGGCGGAGAGCAGGAACGAGAGGAGGTGGACCTGGATCCGTTTCTCCGGGCCAGGACTCGAGCGGCCCCAGCTACCGCTACCCGCCGGCGCCGTCCC

CTATCCATCAACCCTCCTGCACCCATCCGCGACCCTGGGCTCTCTGCGCGTCGGGCCGGGGCTGGAGCGGCGCGGCCGCAG - UNI27756 - ACTGT

CTGGCTTCCCCACTATGCCCATGCTTTGCTAAGTGCTGGTGGCCATCGAAGTTTTTGCATCCTGGGGACGAATCCTGAGCTGACCAGAGACGGACGGCGC

AAG - UNI32962 - GTCCGGGCTCTGGTTCCCTGTGAGAAGCTGCCACGGCCCACCGAGATGTCCAGGCACCACAGCCGCTTCGAAAGAGATTACCG

CATAGGCTGGGACCGCCGTGAGTGGAGCGTCAATGGGACCCACGGGGCCACCAGCGTCTGCAGCGTCACCTCCGGTGCTGGTGGCAGCACAGCCAGCAGT

CTCAGCGCAAGACCGGGCCTCCTACCACTGCCTGTGGTACCCTCCCGGCTGCCCACACCCGCCACGGCTCCTGCTCCCTGCACGACCGGCAGCAGTGAAG

CTATCACCAGTCTTGTGGTCAGCTCGGCCTCCGCAGCCACCACCAAG - UNI32962 - GCTCCCGGCATCTCCAAAGCTGACAATCAGTCTCAAGGA

CTCACGACCAGCATCCGATGGGGGCAGACGCCTGTCAATCAGTCCACGCCCTGGGACACTGATGAGCCGCCCTCCAAACAGATGAGGGAGAGCGACAATC

CAG - UNI32962 - GCACAGGGCCATGGGTGACCACGGTGGCCGCTGGAAACCAGCCTTCCCTGATCACACACTCCTATGGAGTGACCCAGCCTCCC

ACCTTCAGTCCTGCTGTGAACGTCCAGGCCCCCGTCATCGGGGTGACTCCCTCACTGCCTCCCCATGTGGGACCCCAGCTCCCGCTGATACCAGGCCACT

ACTCACTCCCACAGCCGCCCTCCCAACCGCTGAGCAGTGTGGTGGTGAACATGCCTGCTCAGGCCCTGTATGCCAGCCCTCAGCCCCTGGCAGTATCCAC

TTTGCCTGGAGTAGGGCAGGTATCCCGCCCGGGACCCACCCCTGTGGGCAACGGCCACATGGCAGGGCCCCTGCTGCCTCCACCTCCACCAGCCCAGCCG

TCCGCAGCTCTCCCCAGTAGTGTTCCTGCCACCAATGGGCCGCCCACAACAGACTCGGCCCATGGGCTGCAAATGCTTCGGACCATTGGAGTGGGGAAGT

ATGAGTTCACCGACCCAGGGCACCCTAAAG AAATGTTGAAGGAATTGAACCAGCAACGCAGAGCGAAAGCATTTACAGACCTGAAAATTGTTGTTGAAG

GCAGAGAGTTTGAAGTCCACCAAAATGTTCTAGCTTCCTGCAGCTTGTATTTCAAGGACCTGATTCAAAG GTCGGTGCAGGACAGCAGCCAGAGCAGCC

GGGAGAAGTTGGAGCTGGTGCTCTCCAACCTGCAGGCTGATGTCCTGGAGCTACTGCTAGAGTTTGTCTACACGGGGTCGCTGGTCATCGACTCAGCCAA

TGCCAAGACTCTACTCGAGGCGGCCAGCAAGTTCCAGTTTCACACCTTCTGCAAAGTCTGTGTGTCCTTTCTAG AGAAGCAGCTGACTGCCAGCAACTG

TCTGGGAGTGCTGGCCATGGCTGAGGCCATGCAGTGCAGTGAGCTCTACCACATGGCCAAGGCCTTCGCGCTGCAGATCTTCCCCGAGGTGGCCGCCCAG

GAGGAGATCCTCAGCATCTCTAAAGATGACTTCATTGCCTACGTCTCCAATGACAGCCTCAATACCAAGGCCGAGGAGCTGGTCTACGAGACTGTCATCA

AGTGGATCAAGAAGGACCCAGCAACACGTGCACAG TATGCAGCAGAGCTCCTGGCTGCCGTCCGCCTCCCGTTCATCCATCCCAGCTATCTGCTCAATG

TGGTGGACAACGAAGAGCTGATCAAGTCATCAGAAGCATGTCGGGACCTGGTCAATGAGGCTAAACGCTACCACATGCTACCCCACGCCCGGCAGGAGAT

GCAGACACCCCGAACCCGGCCCCGCCTCTCTGCAG GTGTGGCCGAGGTCATCGTTTTGGTTGGGGGCCGTCAGATGGTTGGGATGACCCAGCGCTCACT

GGTGGCTGTCACCTGCTGGAACCCACAGAACAACAAGTGGTACCCCTTGGCCTCGCTGCCTTTCTATGACCGCGAGTTCTTCAGTGTAGTGAGTGCTGGG

GACAACATCTACCTCTCAG GTGGTATGGAATCAGGGGTGACGCTGGCTGATGTCTGGTGCTACATGTCCCTGTTGGATAACTGGAACCTGGTCTCCAGA

ATGACTGTCCCTCGTTGTCGCCACAATAGTCTCGTCTATGATGGGAAGATCTACACTCTTGGGGGACTTGGAGTGGCCGGCAACGTGGACCATGTGGAGA

G GTACGACACTATCACTAACCAATGGGAGGCAGTAGCCCCTCTGCCCAAGGCGGTACATTCGGCAGCGGCCACTGTGTGTGGTGGCAAAATCTACGTGT

TTGGTGGCGTGAATGAGGCAGGCCGAGCGGCAGGTGTCCTCCAGTCCTATGTGCCACAGACCAACACGTGGAGCTTCATTGAGTCCCCAATGATAG ACA

ACAAATATGCACCTGCTGTCACCCTCAATGGCTTTGTGTTCATCCTGGGAGGAGCTTATGCCAGAGCCACCACCATCTACGACCCAGAAAAAGGCAACAT

CAAGGCGGGGCCAAACATGAATCACTCTCGGCAGTTCTGCAG TGCCGTGGTGCTCGATGGTAAAATTTATGCTACTGGAGGCATCGTGAGCAGTGAGGG

ACCAGCCCTGGGCAACATGGAAGCCTACGAGCCCACAACCAACACATGGACCCTCTTACCCCACATGCCCTGTCCTGTGTTCAGACACGGCTGTGTTGTG

ATAAAAAAGTATATTCAAAGCGGCTGACGTCAGCAGAAAGCCCAAGACAAGTCTATGGGACAAGTCCAGTGAGGCGAATGCCACACAACATGGTTATCTT

TCAACGCCAACGAGAGGCCCACAAAACACAATCGAGAAACTCACTGCGCTAACATTTCGAATATTCTCTACATTGAATGTAGAAAATCATCCTCGCCTTT

TGGGTGAAGAGGGGCACAGTGCTCCGGGCAGCAGGAACCTGGAATGCACGGAGCCCGGGCTCCCAGGCCAGCGAGGCACTTGCTCTGAACAGAGGGCGCT

CGCTCTGCCCGGTGCAATAGTTTCACATATTTTTCAACTGGGAGAGAAGCTGTTTTTTTCCTTCTTGCAGAGCAAGCTTGATCCCTAAACCACCATAGAT

CAGTTATCCTGTGACAATTTGGGGCATCACGCTCTTTTGGAATAAGGTCAAAGTGTCCTTATCACTTTGATTCCTACTTTTTTTTTTTTTTTTTGGAGTT

TTTTGGGTTTTGTTTTTGTTTTTCTTAAACCTATCTATACTTTCAAGTGGCCGAGAGAAAAAGGAGGAATGGAACTGTGCAGCACCAAGGCCTCGGAGAG

CGCCTGGTGCCACTAGACAGGATGGAGGGCCAGCTGCACGTGCAGAGCCAGGGCTGGCAGCCGCAGGGGTCGCTGGGAAGAGCAGCCAGGGTCGGCAGCC

GCCAGGGTCGCTGGGAAGAGCCGCCTGTCCTTCATGGCTTTTTCTACCATGTTTTTGCTGCAAAAGAACATGGTGGGTATGCTAGCTTTCTCTTAGCCAG

TATGAATTATTTAGATTTCCAAGGCATTTTCTTGATACACAAAAGGCTATTTTTAAGTACCGAGAGAAGGAGGCCACAGGAGGGACAACGCTGTGGGACT

TCCCAAAGCTCTTTGTAGGTAGCGCCAGAGGTAGGGCCCTTGCTCTCATTTTTCTATGTGCAGAATAGAGGATCTCTCCTGAGGTGGGCCATGCCCCCCA

CTTTATTTTTGGAAAAAGTTAACTCCCAGACAGTCCTGGAAGACCATGCCATGTGGAGGCATTGTCAGAGGGAAGGGTCTATTCTAGAAGAACATGGTTC

TGGCTTCTGACAACAGTCCAGCTCCCTCCATGAGGTAAAGCTGACGACCCAGGCCCCGGGAAAGGGACTGAGGGAGGGAGGGAGGGAGAAGAAATGTCTA

CAAAGCACAGGAGACTATTTTTGATATTTATAGCTATATATTCAAGGCACCTGCCATGAGAGCTCTCAGGATGGGGACAGCCTTCTTAGACGAGCCATGA

CAGTCACGGCCTGAGAGGCACAAGCAGAAACACTCTTCTTGTTGCCTTTCTGCATAGTAACCTGAGAAAAGGGAAGGCAGGAGAGGTCCCAGCGAGGCTC

AAAAGAGAAAGGCCTTCCCTTTAGTCCTTAGACCCTCAAACCTCACCCGGTCATCAGTTTCCATTCCAGGGCAGGAAGAAGGCCGCCGCCACCGTGCTGT

TTAGTTGAAGTTAGTACCAAATACACACCATTTTGCTACCTGGAAAGTCAGCTTGCCATCACATCATGACAAGAACCATTGACAGAGAGAAAGAGACACT

ACATGCTTTCATCATTCAGTATTGGATGACCCAAAATTCCAGTCCTAACGACAGGCATCAGCCTCTAGCATTACAAGTGTGGCTCCCACTTGACAAGATA

CCGAGCTTCGTTATGCAGTTTTTAATATTATTTATTATTTTAAAAAAGTAATAAGCACAAAACTACATACATTGTATGTCATTTAAAGTATTTATGTCAA

ACAGGGTGCAAGTGTGAACCCAAGGACTGGAGCACAAATTTCTAACTGCCTGGGGCAGGGCGAATGTGAGCATTGGTGTGTGTCTGCCTCCAAGGGAGGT

GTTAGTGGTCAACAAGACTCCGCGGTGACACTGAAATTCCGTTTCTCTCCTCATCTATCACACTGGAGCAAAACTGGCTATTTCTGTGAATGATATAAAA

CAGGGTTCTCTGTAATGGTATTGTATATAGTATATGTTTATTGTTAAGTTGTTATATTATAATAAATATATTTATAGATCT
Translation
 - UNI27756 -  - UNI32962 -  - UNI32962 -  - UNI32962 - MPAQALYASPQPLAVSTLPGVGQVSRPGPTPVGNGHMAGPLLPP

PPPAQPSAALPSSVPATNGPPTTDSAHGLQMLRTIGVGKYEFTDPGHPKE EMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASCSLYFKDLIQR R

SVQDSSQSSREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFCKVCVSFLE EKQLTASNCLGVLAMAEAMQCSELYHMAKAF

ALQIFPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPATRAQ YAAELLAAVRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAK

RYHMLPHARQEMQTPRTRPRLSAG GVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSG GGMESGVTLADV

WCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVER RYDTITNQWEAVAPLPKAVHSAAATVCGGKIYVFGGVNEAGRAAGVLQSY

VPQTNTWSFIESPMID DNKYAPAVTLNGFVFILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCS SAVVLDGKIYATGGIVSSEGPALGNMEAYEPTT

NTWTLLPHMPCPVFRHGCVVIKKYIQSG

For any suggestions or comments, please send an email to unitrap@crg.es