Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020692 (Nle1)
Chromosomal location
Chr 11: 82714273 - 82721873 (-)
Description
notchless homolog 1 (Drosophila) Gene [Source:MGI (curated);Acc:Nle1-001]
RefSeq_dna
NM_145431 
RefSeq_peptide
NP_663406.1 
UniGene
Mm.29176 Mm.452566 
MGI
MGI:2429770 
Uniprot/SWISSPROT
Q8VEJ4 
Uniprot/SPTREMBL
B1ARD5 Q3TC83 Q3URT5 
Human Ortholog
ENSG00000073536 (NLE1)
Omim not available
UniTrap UNI7000
Vector Insertion
Chr 11: 82718487 - 82718779
Public Clones RRZ243 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000103213
Sequence
ACGTGGGGACGCAGGATGGCGGCGGCGGTGGTG GAAGAGGCGGCGGCAGGCGACGTGCAGCGGCTGCTCGTACAGTTCCAGGATGAGGGCGGTCAGCTG

CTGGGCTCCCCGTTCGACGTGCCAGTGGACATCACGCCGGACAAGCTGCAGCTGGTGTGCAACGCGCTGCTGGCCCAG GAGGAGCCCCTGCCCCTGGCG

TTCTACGTCCACGATGCTGAGATTGTGTCCTCCCTGGGGAAGACGCTGGAGTCCCAGTCTGTGGAGACAGAGAAAATCGTCGATATCATCTACCAGCCCC

AAGCTGTCTTCAGGGTCCGGGCTGTGACGCGGTGCACCAGCTCATTGGAGGGTCACAGCGAAGCTGTCATTTCTGTGGCCTTCAGCCCCACAGGAAA GT

ACCTGGCCAGTGGTTCCGGAGACACCACTGTGCGCTTCTGGGATCTCAGCACTGAGACACCGCACTTCACATGCAAAG GACACCGGCACTGGGTCCTTA

GCATATCCTGGTCCCCAGATGGCAAGAAACTGGCCTCAGGCTGCAAGAATGGCCAG GTTCTGCTGTGGGACCCAAGCACGGGGCTGCAGGTGGGCAGGA

CCCTCACTGGCCACAGCAAATGGATCACAGGCCTGAGCTGGGAGCCCCTTCACAT - UNI7000 - GAACCCCGAGTGCCGCTACGTGGCCAGCAGCT

CCAAAGACGGCAGTGTACGAGTCTGGGATACAACCGCAGGCCGCTGTGAACGCATCCTCACGGGACACACGCAGTCAGTCACCTGCCTCCGATGGGGAGG

AGATGGGCTTCTATATTCTGCTTCCCAGGACCGAACCATCAAAGTCTGGAGGGCCCATGAC GGTGTGCTGTGTCGTACTCTTCAAGGTCATGGCCACTG

GGTGAACACTATGGCACTTAGCACAGACTATGCCCTGCGCACAGGGGCCTTTGAGCCTGCTGAAGCCACAGTGAATGCCCAAGACCTGCAGGGGTCCT T

GAAGGAGCTGAAGGAGAGGGCATCGAGCCGCTACAACCTTGTGCGG GGCCAAGGCCCAGAGAGGCTGGTCTCTGGCTCAGACGACTTCACCTTATTCCT

GTGGTCCCCAGCAGAGGACAAGAAGCCCCTCGCCCGGATGACAGGACACCAGGCCCTCATCAACCAGGTGCTCTTCTCTCCTGACTCGCGCATCGTGGCC

AGTGCCTCCTTCGACAAGTCTATCAAGCTGTGGGATGGCCGGACGGGCAA GTACCTAGCTTCCCTGCGTGGCCACGTGGCGGCCGTGTACCAGATTGCC

TGGTCAGCTGACAGCCGACTATTAGTCAGCGGCAGCAGTGACAGCACGCTGAAGGTGTGGGATGTGAAGGCCCAGAAACTGGCCACGGACCTGCCTGGCC

ATGCCGATGAG GTATATGCTGTTGACTGGAGTCCAGATGGCCAGAGAGTAGCAAGCGGCGGGAAAGACAAGTGCCTCCGGAT ATGGAGAAGATGACTC

CACAGCTTATTGACCCCCCCTCCCCGGATTCAACCCCCACCTGCCCTGCCAGAGACCAAGGAATGCACACGACCACCTGCCTGCCCAGGACAGGTCTCCA

GTGTGTGACAGTCAGGACATTACAGCGTGGAGCTAAGCCATGGGCACTTCCTGGCAGTGGGGAAGCCAGGCATCTGGCTCCCATGTCCTTTTCCAAGGGT

CAGCTGTGAAGGCCCAGACCCTAGGCTATGCGTGTGTCCAAATAAATAACTTATATTTTTGTGT
Translation
MAAAVV EEAAAGDVQRLLVQFQDEGGQLLGSPFDVPVDITPDKLQLVCNALLAQ EEPLPLAFYVHDAEIVSSLGKTLESQSVETEKIVDIIYQPQAVF

RVRAVTRCTSSLEGHSEAVISVAFSPTGK KYLASGSGDTTVRFWDLSTETPHFTCKG GHRHWVLSISWSPDGKKLASGCKNGQ VLLWDPSTGLQVGR

TLTGHSKWITGLSWEPLHM - UNI7000 - MNPECRYVASSSKDGSVRVWDTTAGRCERILTGHTQSVTCLRWGGDGLLYSASQDRTIKVWRAHD GV

LCRTLQGHGHWVNTMALSTDYALRTGAFEPAEATVNAQDLQGSL LKELKERASSRYNLVR GQGPERLVSGSDDFTLFLWSPAEDKKPLARMTGHQALI

NQVLFSPDSRIVASASFDKSIKLWDGRTGK KYLASLRGHVAAVYQIAWSADSRLLVSGSSDSTLKVWDVKAQKLATDLPGHADE VYAVDWSPDGQRVA

SGGKDKCLRI IWRR

For any suggestions or comments, please send an email to unitrap@crg.es