Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020705 (Ddx42)
Chromosomal location
Chr 11: 106078240 - 106110453 (+)
Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 42 Gene [Source:MGI (curated);Acc:Ddx42-001]
RefSeq_peptide
NP_082350.3 
UniGene
Mm.41367 Mm.368407 Mm.473458 
MGI
MGI:1919297 
Uniprot/SWISSPROT
Q810A7 
Uniprot/SPTREMBL
Q8VE45 Q9CTM9 
Human Ortholog
ENSG00000198231 (DDX42)
Omim not available
UniTrap UNI6873
Vector Insertion
Chr 11: 106078471 - 106085394
Public Clones (sanger) BGA637 (baygenomics) D027H03 (ggtc) D041B10 (ggtc) D030E11 (ggtc)
PST8513-NR (escells) PST3925-NR (escells) IST14666B4 (tigm) IST14185G5 (tigm)
IST14185E4 (tigm)
Private Clones OST223276 (lexicon) OST189771 (lexicon) OST33418 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23909
Vector Insertion
Chr 11: 106085633 - 106086097
Public Clones not available
Private Clones OST240696 (lexicon) OST194129 (lexicon) OST180306 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2605
Vector Insertion
Chr 11: 106098438 - 106099821
Public Clones XR0874 (sanger) XR0882 (sanger) IST13558A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37919
Vector Insertion
Chr 11: 106101414 - 106102864
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37520
Vector Insertion
Chr 11: 106104416 - 106106640
Public Clones PST17213-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021046
Sequence
GCGCATGTCAGACGCTCCCCCCACCCTACCCCCAGTCAGCAACGGGCCGTGAGGCGGCGGCGAAGGGGGCGGAGGAAGAGCGCGGCTGGACGCGGTCCCG

CACCGCGCGTACGCAGGGCCGCGGGGGTTCTTTCGCGCCGACTGGAGTAGCAACTGCGTCTGCAGCCGCGGCAGCGGGTTTGGGTGAAGGGCTCGCCAGA

CGCAGTGCCGCTAGCCCGGGGGACACGAGAG - UNI6873 - CACCAGTCATTGGCATCATGAACTGGAATAAAGGCGGCCCTGGAACCAAGCGGGGA

TTTGGTTTTGGAGGTTTTGCTATCAGTGCTGGGAAGAAGGAGGAAGCCAAACTGCCACAGCAGTCCCATAGTGCCTTTGGGGCAGCCAGCTCTTCTTCTG

GATTTGGAAAGTCTGCTCCACCACAGCTTCCTTCTTTCTACAAAATTGGATCTAAACGGGCCAACTTTGATGAAGAAAATGC - UNI23909 - GTAT

TTTGAAGATGAAGAAGAAGACTCCAGCAATGTAGATTTACCTTACATTCCTGCTGAAAACTCACCTACCCGCCAGCAGTTCCATTCCAAGCCCGCAGACT

CTGACAGTGATGATGACCCCTTAGAGGCATTCATGGCTGAAGTGGAG GATCAGGCTGCTAGAGACATGAAGAGACTTGAAGAAAAGGACAAGGAAAGAA

AAAACGTCAA GGGTATTCGAGATGACATTGAAGAGGAAGATGACCAA GAAGCTTATTTTCGATACATGGCAGAGAACCCAACTGCTGGGGTGGTTCAG

GAGGAAGAAGAGGACAATTTGGAGTATGACAGTGATGGAAATCCAATTGCACCTTCCAAAAAAATTATCGATCCCCTTCCTCCCATTGATCATTCGGAG 

ATTGACTATCCACCATTTGAAAAAAATTTTTACAATGAACATGAGGAGATAACCAACCTCACTCCACAGCAGTTGATAGACCTGCGACATAAGCTCAACC

TTCGG GTCTCTGGTGCTGCACCTCCCAGACCAGGAAGTAGCTTTGCTCATTTTGGGTTTGATGAACAACTTATGCACCAGATTAGGAAATCTGAGTACA

CACAGCCGACCCCAATACAGTGTCAG GGTGTACCTGTAGCACTAAGTGGGAGAGACATGATTGGTATTGCTAAAACAGGCAGTGGGAAAACTGCAGCCT

TTATTTGGCCCATGTTGATTCATATAATGGATCAGAAGGAATTGGAACCAGGTGATGGACCAATTGCAGTTATTGTGTGTCCTACTAGGGAGCTTTGTCA

ACAG ATCCACGCAGAGTGTAAGCGGTTTGGGAAAGCGTATAATCTTCGATCAGTGGCCGTGTATGGAGGAGGGAGCATGTGGGAGCAGGCCAAGGCCCT

TCAGGAAGGGGCAGAGATTGTTGTATGTACCCCA - UNI2605 - GGTCGACTGATTGATCATGTGAAGAAAAAAGCTACTAATCTTCAAAGAGTCTC

TTACCTTGTGTTTGATGAAGCCGATCGAATGTTTGACATGGGATTTG AGTATCAGGTTCGGTCCATAGCAAGTCATGTTCGTCCTGACAGACAAA CTC

TCTTATTCAGTGCAACTTTTCGAAAGAAGATTGAAAAGTTGGCCAGAGACATCTTGATTGACCCTATTCGAGTGGTGCAGGGAGACATTGGAGAG GCGA

ATGAAGATGTGACACAGATTGTGGAGATTCTCCATTCCGGACCCAGTAAATGGAACTGGCTGACTCGGCGTCTGGTGGAGTTTACTTCCTCGGGGAGTGT

GCTCTTGTTTGTTACTAAGAAAGCCAATGCTGAAGAGCTAGCCAGTAACCTGAAGCAGGAGGGTCATAATCTTGGTCTGCTCCATGGGGACATGGATCAG

AGCGAAAGAAACAAGGTTATTTCAGATTTTAAGAAAAAGGACATCCCCGTCCTGGTGGCCACTGATGTTGCAG CCCGTGGTCTGGATATTCCTTCCATT

AAGACAGTCATTAACTATGATGTAGCACGGGACATTGATACGCACACTCACAGGATTGGCCGGACAGGAAGAGCTGGTGAGAAGGGTGTAGCCTATACCT

TATTGACTCCAAAGGACAGCAATTTTGCTGGTGACCTTGTACGGAACCTGGAAGGAGCCAACCAACATGTTTCTAAGGAGCTCTTAGATCTTGCAATGCA

G AATGCCTGGTTTCGGAAATCTCGCTTCAAAGGAGGGAAAGGCAAAAAGCTGAACATTGGTGGAGGAGGCTTGGGCTATAGAGAGCGGCCTGGGCTGGG

CTCTGAGAATTCG GACCGAGGAAATAATAACAATGTAATGAGCAATTATGAAGCCTACAAGCCCTCCACAGGAGCCATGGGAGATAGGCTCACAGCAAT

GAAAGCAGCTTTTCAG TCCCAGTACAAGAGTCACTTTGTTGCAGCCAGTTTAAGTAATCAGAAGGCCGGAACCTCTTCTGCAGGGGCAAGTGGATGGAC

TAGTGCAGGAAGCTTAAATTCTGTTCCAACTAATTCAGCACAGCAGGGCCATAATAGTCCTGACAACCCCATGACCAGTTCTACCAAGAACATCCCAGGC

TTCAACAACTCTGGGAATATCAGTAGTGCCCCAGTGACCTACCCTTCTATTGGAGCCCAAGGAGTCAACAACACAGCTTCAGGGAATAACAGCCGTGAAG

GGATTGGGGGTGGCAATGGGAAGAGAGAGAGATATACTGAGAACCGGGGTGGTAGCCGTCATAGCCATGGAGATGGTGGCAATCGGCATGGAGATGGTGG

GCGCCATGGAGATGGATACCGTTATCCAGAAAGTGGTAGCCGTCATACTGATGGCCACCGACATGGAGAGACCAGGCATGGAGGAAGTGCCGGCAGACAC

GGAGAGAGCCGGGGTGCAAATGATGGCAGGAATGGAGAAAGCAGGAAAGAAGGTTTTAATCGTGAAAACAAGATGGACCCCAAGGTGGATAGCAGCAGGA

TGGACAAAGTGGACAGCAAGACAGATAAGACACCTGATGGCTTTGCTGTTCCAGAGCCACCCAAAAGAAAGAAAAGCCGATGGGATAGTTAGAGGGTATG

TGAAAATCAGCGTCGTCAGTCGTCTTTAATTTTATTTTTAGAAAGATTTTGGTAATGAGGCGTCTCAGGGCTGGGTTGGGGTCCAAGATATACAGACCCC

CTGCCCTTGGTGGAGAACTGGAGAGTGGATTGTACCTTCATCTGGTGTTCATTCAGAGGTTTCCTTGGGAACCTGAGCTGGCCCTGGAAAGCAGAGAGCT

GGGAAGCTTTTGTTTGTTGTGGGTGAGTTTTAAGGAGGGTAAGTAGAATACTTAGGGAGAAAGGGCCTTTTAGGGCACAAAAACTCACTCTAGGTTTATA

ATAGCTTATATTTTTTACTAAAATGTCACCTTATAAACATCTATAAATTGGACTTTTTTTCTTAGCTGTGGCCAGGCAGTCCCAACTTCTGCCCTGTTAG

GGATGCTTGGGGAGCAGTGGTGCTTTCAGATGTTTGCAGGGAAGATGCCTGAGCGCTCAGGTTCCCCAGACTGTTTCCAGCCCTGAGACACGTAGGAAAG

ACAGCCTTCCAGACACAGGCTTTGAAATCCTAAGCCATTAGGACTGAAGGAATGATCATCTTGGAAGGATTCCAGGATAATCCAGGCCTGGAGTACTGCT

AAATTTACCATTTAAAACCAACCCCAACAGTAGCATTCAAAGTGTCTATTTGTTTTGTTTTGTTTTTTTAAACTTGCCCTAATAGTAGAAAAAAGTCTTC

TGCTGAAATGATTTTGATTTTTGTTCTATCTTGTTTATAAAAGAAAAATATACAAACTTTGAATTTTGTGATTTTTGTGAAGGTTTCTTTAAGATGTGCA

TTCCCTCTCTGCTTGCTCGATAGTAAATGTCTTACTACTGGGACCTGAGGGCTGTCGTTTCTACCATACAAGTTAGTTGCTACATATTAAATTATGGCTT

GGAACAGTACAGCCCATGATGTGAAATGTGGGGAAGTGCTTGCTTATTAAACTATCAGAAAAGTT
Translation
 - UNI6873 - MNWNKGGPGTKRGFGFGGFAISAGKKEEAKLPQQSHSAFGAASSSSGFGKSAPPQLPSFYKIGSKRANFDEENA - UNI23909 -

 AYFEDEEEDSSNVDLPYIPAENSPTRQQFHSKPADSDSDDDPLEAFMAEVE DQAARDMKRLEEKDKERKNVK KGIRDDIEEEDDQ EAYFRYMAENP

TAGVVQEEEEDNLEYDSDGNPIAPSKKIIDPLPPIDHSE IDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLNLR VSGAAPPRPGSSFAHFGFDEQLMH

QIRKSEYTQPTPIQCQ GVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQ IHAECKRFGKAYNLRSVAVYGGG

SMWEQAKALQEGAEIVVCTP - UNI2605 - GRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFE EYQVRSIASHVRPDRQT TLLFSATFRKKIEK

LARDILIDPIRVVQGDIGE ANEDVTQIVEILHSGPSKWNWLTRRLVEFTSSGSVLLFVTKKANAEELASNLKQEGHNLGLLHGDMDQSERNKVISDFKK

KDIPVLVATDVAA ARGLDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAGDLVRNLEGANQHVSKELLDLAMQ NAWFRKSRF

KGGKGKKLNIGGGGLGYRERPGLGSENS DRGNNNNVMSNYEAYKPSTGAMGDRLTAMKAAFQ SQYKSHFVAASLSNQKAGTSSAGASGWTSAGSLNSV

PTNSAQQGHNSPDNPMTSSTKNIPGFNNSGNISSAPVTYPSIGAQGVNNTASGNNSREGIGGGNGKRERYTENRGGSRHSHGDGGNRHGDGGRHGDGYRY

PESGSRHTDGHRHGETRHGGSAGRHGESRGANDGRNGESRKEGFNRENKMDPKVDSSRMDKVDSKTDKTPDGFAVPEPPKRKKSRWDS

For any suggestions or comments, please send an email to unitrap@crg.es