Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020709 (Centa2)
Chromosomal location
Chr 11: 79967613 - 79992417 (+)
Description
ArfGAP with dual PH domains 2 Gene [Source:MGI (curated);Acc:Centa2-001]
RefSeq_dna
NM_172133 
RefSeq_peptide
NP_742145.1 
MGI
MGI:2663075 
Uniprot/SWISSPROT
Q8R2V5 
Uniprot/SPTREMBL
Q3V340 Q5SSK2 
Human Ortholog
ENSG00000184060 (CENTA2)
Omim not available
UniTrap UNI21628
Vector Insertion
Chr 11: 79975763 - 79979174
Public Clones (ggtc) IST14955H8 (tigm) IST11217H6BBF1 (tigm)
Private Clones OST323510 (lexicon) OST271949 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34827
Vector Insertion
Chr 11: 79979322 - 79984179
Public Clones IST13758F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17373
Vector Insertion
Chr 11: 79984264 - 79987589
Public Clones IST12077D4 (tigm) IST11055D8 (tigm)
Private Clones OST443791 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22659
Vector Insertion
Chr 11: 79987653 - 79989557
Public Clones IST13749E3 (tigm) IST11227C9 (tigm)
Private Clones OST288707 (lexicon) OST148772 (lexicon)
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21030
Vector Insertion
Chr 11: 79989636 - 79990547
Public Clones IST14886A1 (tigm) IST14182H9 (tigm) IST13723E10 (tigm) IST12077B2 (tigm)
IST11811B2 (tigm) IST14577D2 (tigm) IST12077C1 (tigm) IST11812B1 (tigm)
Private Clones OST345519 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31031
Vector Insertion
Chr 11: 79990777 - 79991897
Public Clones (ggtc) IST13723E10 (tigm) IST14072B2 (tigm) IST14145C3 (tigm) IST12072C9 (tigm)
IST14454C3 (tigm) IST13807H2 (tigm) IST14143D5 (tigm) IST12077C1 (tigm)
IST14581H5 (tigm) IST14388A11 (tigm) IST14881D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021050
Sequence
CTGAATCCTTCTCCGGCGGACAGGGAAACGCCGGACCATGGGCGTCCAGGAGCGGGAAGCACAGAGGTGGCAGGGTTGAGCCCCGCTGAGACCTCTGGGC

CGGCCATGGGCGACCGCGAGCGCAACAAGAAGCGGCTGCTGGAGCTGCTGCAGGCTGCGGGCACCGGCAACGGGCACTGCGCCGACTGCGGGGCAGCGG 

ATCCTGATTGGGCCTCTTACAAGCTGGGGATTTTCATCTGTCTCCACTGCTCTGGCGTCCACCGCAACTTCCCAGACATCAGCAAAGTTAAATCCGTGAG

ACTGGACTTCTGGGACGACAGTATGGTGGAG TTCATGACTCACCATGGGAACCTCAACGTGAAAGCCAAGTTTGAAGCAAGAGTCCCAGCTTTCTACTA

TGTCCCTCAGGCCAACGACTGCCT GGTCTTAAAGGAACAATGGATTCGAGCTAAGTATGAAAGACAGGAGTTTACGGCTATTGACAAAGCTGTCTCACA

TCCAG GTAACCGAGAAGGGTTCCTGTGGAAGCGAGGACGGGACAACGCACAGTTCCTGAGAAGGCGGTTTGTCCTTCTGTCGAGGGAAGGCCTCCTGAA

GTACTACACCAAGGAGGAG - UNI21628 - GGTAAAGCCCCAAAGGCTGTCATCAGCATCAAGGACTTAAACGCCACCTTCCAGACAGAGAAGATAG

GACATCCCCACGGGCTGCAGATCACCTACAGGAAAGAGGGCCACACCAGGAACCTGTTTGTTTATCATGACAGTGGGAAG GAGATAGTGGATTGGTTCA

ATGCTCTCCGTGCAGCCCGCCTGCAATACCTGAAATTGGCCTTTCCTGATCTCCCAGAGTCTGAG - UNI17373 - CTCGTGCCTCTCATCACCAGG

AACTACCTCAAACAAGGCTTCATGGAGAAGACTGGTCCAAAG - UNI22659 - CATAGAGAACCCTTCAAGAAAAGATGGTTTGCCTTGGATCCGCA

GGAACGGAGGCTGCTCTATTATAAGAACCCCCTG - UNI21030 - GATGCTTTTGAGCTGGGCCAGGTTTTTCTGGGAAGCAATGAGCAGGGATATG

AAGTATGGGAAGATCTGCCCAAGGGCATCCGAGGGAACCGCTGGAAGGCTGGACTTACCGTCATCACTCCGGAGCGGAAATTCATCTTCACCTGCCCCAC

TGAAAAGGAACAGCGAGAATGGCTAGAGAGTCTGCGGGGCGTCTTGTCCAGTCCCTTGTCACCCCTCCACCTCCTCA - UNI31031 - CCACATCAG

CAGAGACTGGCTGTGGCCTGGGGTGACCCATCTCGGAGGATCTGGCTGGCTACTGTGCATCTGAAGTTCTGGAGAAGTGTTCACCTCAGCCCTAGTTGTC

CAGAAGGAAGCCCTGAGGCCAGCAGCTGCCCCACTAGTGAACTCCAGGGTGTGGTTGATCCTACGACTCCCCGTGCTCCTTCCAGCAAACTCTCCTCAGT

CTTGAGGAGCTGGTATGGAGAAGAATTCAGCTCTCCAAGCTTAGAAGTCCTGAAGGGTTCCTCATAACTGCACCAAGAGCTGGCCATGGTGACGCATGCC

AGGCAAGAGGCGAGGGTGCCATGAGCCCAGTGACAACCTGGACTACACTGGGGGTTCAGTTCAGCCTGAGTTACATAGCAAGACCTTGTCTCAGAAACAA

ACAAACAAACAAACCAAAAACCAGAACAGAAAAAAACAGCACTCAGGAGGCAGAGACTGGCAGATCTGGGACAGTCACAGCCAGGGCAGGTTACACTGAG

AAACCCTGTCT
Translation
MGDRERNKKRLLELLQAAGTGNGHCADCGAAD DPDWASYKLGIFICLHCSGVHRNFPDISKVKSVRLDFWDDSMVE FMTHHGNLNVKAKFEARVPAFY

YVPQANDCL LVLKEQWIRAKYERQEFTAIDKAVSHPG GNREGFLWKRGRDNAQFLRRRFVLLSREGLLKYYTKEE - UNI21628 - GKAPKAVIS

IKDLNATFQTEKIGHPHGLQITYRKEGHTRNLFVYHDSGK EIVDWFNALRAARLQYLKLAFPDLPESE - UNI17373 - LVPLITRNYLKQGFMEK

TGPK - UNI22659 - HREPFKKRWFALDPQERRLLYYKNPL - UNI21030 - DAFELGQVFLGSNEQGYEVWEDLPKGIRGNRWKAGLTVITPE

RKFIFTCPTEKEQREWLESLRGVLSSPLSPLHLLT - UNI31031 - TTSAETGCGLG

For any suggestions or comments, please send an email to unitrap@crg.es