Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020716 (Nf1)
Chromosomal location
Chr 11: 79153394 - 79395111 (+)
Description
neurofibromatosis 1 Gene [Source:MGI (curated);Acc:Nf1-003]
RefSeq_dna
NM_010897 
RefSeq_peptide
NP_035027.1 
UniGene
Mm.255596 Mm.401457 
MGI
MGI:97306 
Uniprot/SWISSPROT
Q04690 
Uniprot/SPTREMBL
B1AQE7 Q3TYD2 Q5SYH9 Q8BQG3 Q8CCE8 B1AQE8 
Human Ortholog
ENSG00000196712 (NF1)
Omim 114500 - COLORECTAL CANCER  162200 - NEUROFIBROMATOSIS, TYPE I  162210 - NEUROFIBROMATOSIS, FAMILIAL SPINAL  193520 - WATSON SYNDROME  601321 - NEUROFIBROMATOSIS-NOONAN SYNDROME  607785 - JUVENILE MYELOMONOCYTIC LEUKEMIA  
UniTrap UNI26136
Vector Insertion
Chr 11: 79197625 - 79197676
Public Clones not available
Private Clones OST135249 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26846
Vector Insertion
Chr 11: 79232186 - 79239014
Public Clones IST12416G7 (tigm)
Private Clones OST91812 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2993
Vector Insertion
Chr 11: 79239150 - 79242079
Public Clones XR0618 (sanger) CMHD-GT_539A6-5S (cmhd) IST13152B12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22763
Vector Insertion
Chr 11: 79242194 - 79248346
Public Clones not available
Private Clones OST285307 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22044
Vector Insertion
Chr 11: 79248427 - 79250191
Public Clones not available
Private Clones OST310637 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25725
Vector Insertion
Chr 11: 79252351 - 79254349
Public Clones not available
Private Clones OST168939 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4459
Vector Insertion
Chr 11: 79255477 - 79257270
Public Clones AA0320 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34152
Vector Insertion
Chr 11: 79261168 - 79261626
Public Clones IST11305B1 (tigm) IST11189H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8765
Vector Insertion
Chr 11: 79284936 - 79285084
Public Clones XF344 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27959
Vector Insertion
Chr 11: 79289386 - 79349104
Public Clones not available
Private Clones OST43325 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000071325
Sequence
CTCAGCCGCTCGGCTCGCCGCTGCCCTCACCTCCGCGCCGGCCGCCCGCCCGCCCTCAGGCGGGCCCCGGACGCCGGCCCTCCACCGCCCCCGGGTCGCC

GGGAGGACATGGCCGCACACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAG - UNI26136 - CTTCCAATAAAGACAGGA

CAGCAGAACACACATACCAAAGTCAGCACCGAGCACAACAAGGAGTGTCTGATCAACATTTCCAAATACAAGTTTTCTCTGGTCATCAGTGGGCTCACCA

CCATCCTAAAGAATGTTAACAATATG AGGATATTTGGAGAAGCTGCTGAAAAAAATTTGTATCTCTCTCAGTTGATCATATTGGATACACTGGAAAAAT

GTCTTGCTGGG CAACCAAAGGACACAATGAGATTAGATGAGACAATGCTGGTCAAACAATTACTACCAGAAATCTGCCATTTTCTTCACACCTGCCGTG

AAGGAAACCAACATGCAGCCGAACTTCGGAATTCTGCCTCTGGGGTTTTATTTTCTCTCAGCTGCAACAACTTCAATGCAGTCTTTAGTCGCATTTCTAC

AAG GTTACAGGAGTTGACTGTCTGTTCAGAAGATAATGTTGATGTTCACGATATAGAATTGTTACAGTATATCAATGTGGATTGTGCAAAATTAAAACG

ACTTCTGAAGG AAACAGCATTTAAATTTAAAGCCCTGAAGAAGGTTGCACAGTTGGCAGTTATAAATAGCCTAGAAAAG GCTTTTTGGAACTGGGTAG

AAAATTATCCGGATGAATTTACAAAGCTATACCAAATTCCACAGACAGATATGGCTG AATGTGCAGAGAAGCTGTTTGACTTGGTGGATGGTTTTGCAG

AAAGCACCAAACGTAAAGCAGCAGTGTGGCCCCTACAAATCATTCTCCTTATCTTGTGTCCAGAAATAATCCAGGACATCTCCAAGGATGTGGTGGACGA

GAGCAACATAAACAAG AAGCTGTTTCTGGACAGTTTACGGAAAGCACTCGCTGGCCATGGAGGAAGCAGGCAGCTGACTGAGAGTGCTGCCATTGCTTG

TGTCAAGTTGTGTAAAGCAAGTACTTACATCAACTGGGAAGATAATTCTGTCATTTTCCTACTGGTTCAGTCCATGGTAGTTGATCTTAAG AACCTGCT

TTTTAATCCAAGTAAACCATTCTCTAGAGGCAGTCAGCCTGCAGATGTGGACCTCATGATTGACTGTCTTGTCTCTTGCTTTCGGATAAGCCCTCACAAC

AACCAACACTTTAAG ATCTGCCTGGCTCAGAATTCACCTTCTACATTTCACTATGTGTTGGTAAACTCACTGCACCGCATCATCACCAAT TCTGCGTT

GGATTGGTGGCCTAAGATTGATGCTGTATATTGTCACTCAGTTGAACTTCGCAATATGTTTGGTGAAACACTTCATAAAGCAGTGCAAGGCTGTGGAGCG

CACCCAGCAATACGAATGGCACCA - UNI26846 - AGTCTCACCTTTAAAGAAAAGGTAACAAGCCTTAAATTTAAAGAAAAGCCTACAGACCTAGA

GACAAGGAGCTACAAATGTCTTCTTTTGTCCATGGTGAAACTGATTCATGCAGACCCAAAGCTTTTGCTTTGT - UNI2993 - AATCCAAGAAAACA

GGGCCCTGAAACTCAGAGCAGTACAGCAGAACTAATTACAGGGCTCGTACAACTGGTTCCTCAGTCACACATGCCAGAGGTCGCTCAGGAGGCTATGGAG

 - UNI22763 - GCTTTGCTGGTCCTTCATCAGTTAGATAGCATTGATCTCTGGAATCCTGACGCTCCTGTAGAGACATTCTGGGAAATCAG - UNI

22044 - CTCACAAATGCTTTTTTACATCTGCAAGAAATTAACTAGCCATCAAATGCTTAGTAGCACAGAAATTCTCAAGTGGTTACGGGAAATTCTGA

TCTGCAGAAATAAATTTCTTCTTAAAAATAAG CAGGCAGATAGAAGCTCCTGTCATTCTCTCTACCTTTATGGAGTAGGATGTGAAATGTCTGCTACTG

GAAATACCACTCAGATGTCAGTTGATCATGATGAGTTCCTGCGTGCCTGTACTCCTGGAGCATCTCTGCGGAAAGGAAGAGGGAATTCCTCCATG - UN

I25725 - GATAGCACAGCAGGGTGCAGTGGAACCCCACCTATATGCCGACAAGCCCAGACCAAGCTAGAAGTGGCCTTATACATGTTTCTGTGGAATC

CTGACACTGAAGCTGTTCTGGTTGCTATGTCCTGTTTCCGCCACCTCTGTGAAGAAGCAGATATTCGATGTGGGGTAGATGAAGTGTCAGTACACAACTT

CTTGCCCAACTATAACACATTCATGGAATTTGCCTCAGTCAGCAATATGATGTCAACAG GAAGAGCAGCGCTTCAGAAAAGAGTGATGGCCCTGCTAAG

GCGCATTGAGCACCCTACTGCAGGAAACATTGAG GCCTGGGAAGATACACATGCAAAGTGGGAACAGGCTACAAAACTAATCCTTAACTACCCAAAAGC

CAAAATGGAAGATGGCCAG - UNI4459 - GCTGCAGAAAGTCTTCATAAGACCATTGTTAAGAGACGGATGTCCCATGTCAGTGGAGGAGGCTCCAT

AGACTTGTCTGACACAGACTCCCTGCAGGAGTGGATCAACATGACTGGCTTCCTTTGTGCCCTTGGTGGGGTGTGCCTGCAACAGAGAAGCAGCTCTGGC

CTAGCGACATACAGCCCACCTATGGGCGCTGTCAGTGAACGCAAAGGGTCTATGATTTCTGTAATGTCTTCTGAAGGGAATATTGATTCACCTGTCAGCA

GATTTATGGACCGGCTTCTGTCCTTAATGGTGTGTAACCACGAGAAAGTGGGGCTTCAGATACGGACCAATGTTAAGGACCTGGTGGGTCTGGAGTTGAG

TCCTGCTCTGTATCCAATGCTGTTTAACAAACTGAAGAATACCATCAGCAAGTTTTTTGACTCTCAAGGACAG GTATTACTAAGTGACAGCAATACTCA

GTTTGTAGAGCAAACCATAGCCATAATGAAAAACCTACTGGATAATCATACTGAAGGCAGCTCTGAGCATCTGGGACAAGCGAGCATTGAGACAATGATG

CTAAATCTGGTCAG ATACGTTCGTGTTCTTGGGAATATGGTCCATGCAATACAAATAAAAACAAAATTGTGTCAGTTAGTTGAAGTCATGATGGCAAGA

AGAGATGACCTCTCGTTTTGTCAAGAGATGAAATTTAG GAATAAGATGGTAGAATATCTAACAGACTGGGTTATGGGAACATCAAACCAAGCAGCAGAT

GATGACATAAAATGTCTTACGAG AGATCTGGACCAAGCAAGCATGGAAGCAGTAGTTTCTCTCCTCGCTGGTCTTCCACTGCAGCCCGAAGAAGGAGAT

GGGGTGGAGCTGATGGAGGCCAAATCACAGTTATTCCTTAA GTACTTCACATTATTTATGAACCTTTTGAATGACTGTAGTGAAGTTGAAGATGAAAAT

GCACAAACGGGTGGCAGGAAACGTGGCATGTCTCGGAGGCTGGCATCCCTGAGGCACTGTACAGTGCTTGCAATGTCAAACTTACTCAATGCTAATGTGG

ACAGTGGACTCATGCACTCCATAG - UNI34152 - GCTTAGGTTATCACAAGGATCTTCAGACAAGAGCTACGTTTATGGAAGTTCTGACAAAAATC

CTTCAACAAGGAACAGAATTCGATACACTTGCGGAAACGGTGTTGGCAGATCGATTTGAGAGACTTGTGGAACTGGTCACAATGATGGGAGACCAGGGAG

AACTCCCTATAGCTATGGCTCTTGCCAATGTGGTCCCTTGTTCTCAGTGG GATGAGCTGGCTCGGGTTCTGGTCACTCTGTTTGATTCCCGGCATTTAC

TCTACCAGCTGCTCTGGAACATGTTTTCTAAGGAGGTAGAATTGGCAGACTCCATGCAGACTCTCTTTCGAGGCAACAGCTTGGCCAGTAAGATAATGAC

ATTCTGCTTCAAG GTGTATGGTGCTACTTACCTACAAAAGCTCTTGGACCCTTTATTACGAGTCATCATCACATCTTCGGATTGGCAACATGTTAGCTT

TGAAGTGGATCCTACCAG GTTAGAACCCTCTGAGAGCCTTGAGGAGAACCAGAGGAACCTCCTTCAGATGACAGAGAAGTTCTTCCATGCCATCATCAG

CTCTTCCTCAGAATTCCCCTCACAGCTTCGAAGTGTCTGCCATTGTTTGTACCAG GCAACTTGCCACTCCCTACTGAATAAAGCTACAGTAAAAGAAAG

AAAGGAAAACAAAAAATCA GTGGTTAGCCAGCGCTTCCCTCAGAACAGCATCGGTGCCGTAGGAAGTGCCATGTTTCTCAGATTCATCAATCCTGCCAT

TGTCTCGCCGTATGAAGCAGGGATTTTAGATAAAAAGCCACCACCTAGAATTGAAAGGGGCTTGAAGTTAATGTCAAAG GTACTTCAGAGCATTGCCAA

TCATGTACTGTTCACAAAAGAAGAGCATATGAGACCTTTTAATGATTTTGTGAAAAGCAACTTTGACTTGGCACGAAG - UNI8765 - GTTTTTCCT

AGATATAGCATCAGATTGTCCCACAAGTGATGCAGTAAACCATAGTCTTTCCTTCATCAGCGATGGCAATGTGCTTGCTTTACATCGGCTGCTTTGGAAC

AATCAGGAGAAAATTGGCCAGTATCTTTCCAGTAACAG - UNI8765 - GGATCATAAAGCTGTTGGAAGACGACCTTTTGATAAGATGGCCACACTT

CTCGCGTATCTGGGTCCTCCGGAGCACAAGCCTGTGGCAGATACACACTGGTCCAGCCTTAACCTTACCAGTTCAAAGTTTGAGGAATTTATGACCAG G

CACCAGGTACATGAGAAAGAAGAGTTCAAGGCCTTGAAAACGTTAAGCATCTTCTACCAAGCTGGCACCTCCAAAGCTGGGAATCCTATTTTTTATTATG

TTGCACGGAG - UNI27959 - GTTCAAAACTGGCCAGATCAATGGTGATCTGCTGATATACCATGTCTTGCTGACTTTAAAGCCATATTATGCAAAG

CCATATGAAATTGTAGTGGACCTTACCCATACTGGGCCTAGCAATCGCTTTAAAACAGACTTCCTCTCTAAGTGGTTTGTTGTCTTTCCTGGCTTTGCCT

ATGACAACGTCTCTGCAGTCTATATCTATAACTGTAACTCCTGGGTCAGGGAGTATACCAAATACCATGAGCGGCTGCTGACTGGCCTCAAGGGCAGCAA

AAGGCTCATTTTCATCGACTGTCCTGGGAAGCTGGCTGAACATATAGAGCATGAGCAACAGAAACTCCCTGCTGCTACCTTGGCTTTGGAAGAAGATCTA

AAGGTTTTCCACAATGCTCTCAAGTTAGCTCACAAGGACACCAAAGTTTCTATTAAG GTTGGTTCTACTGCTGTTCAGGTAACTTCAGCAGAAAGAACA

AAAGTTTTGGGGCAATCCGTCTTTTTAAATGATATTTACTATGCTTCTGAAATCGAAGAGATCTGCCTAGTTGATGAGAACCAGTTCACTCTAACCATTG

CAAACCAAGGCACACCACTGACCTTCATGCACCAAGAATGTGAAGCCATTGTTCAGTCTATCATTCATATCAGGACCCGCTGGGAGCTGTCACAACCTGA

CTCCATCCCTCAGCATACCAAGATTCGACCAAAGGATGTCCCTGGGACACTGCTTAATATTGCGTTACTGAATTTGGGCAGTTCAGACCCTAGTTTACG 

GTCTGCTGCCTATAATCTCCTGTGTGCCTTAACCTGCACCTTTAATTTAAAGATTGAAGGTCAGTTGCTAGAGACATCGGGGTTATGCATCCCTGCCAAC

AACACACTCTTCATTGTCTCTATCAGTAAGACGCTCGCAGCCAATGAGCCACACCTCACCTTAGAGTTTTTGGAAGAGTGTATTTCTGGATTTAGCAAAT

CTA GTATTGAATTGAAGCACCTTTGTTTGGAATATATGACCCCATGGCTGTCAAATCTAGTCCGTTTTTGTAAGCATAATGATGATGCCAAACGACAAA

GGGTTACTGCCATCCTTGATAAGCTAATAACAATGACTATAAACGAGAAGCAGATGTATCCTTCTATTCAAGCAAAAATCTGGGGGAGCCTTGGGCAG A

TCACAGACCTGCTGGATGTTGTGCTTGACAGTTTCATCAAGACCAGTGCGACAGGAGGCTTAGGGTCTATCAAAGCTGAGGTGATGGCAGACACAGCTGT

GGCTTTAGCTTCTGGAAATGTGAAATTGGTGTCGAGTAAG GTTATTGGAAGGATGTGTAAAATAATTGACAAGACTTGCTTATCCCCAACTCCAACTTT

AGAACAACATCTTATGTGGGACGACATTGCCATTTTAGCCCGCTACATGCTGATGCTGTCCTTCAACAACTCCCTCGATGTGGCGGCTCATCTGCCCTAT

CTCTTCCATGTTGTCACTTTCTTAGTAGCCACAGGTCCCTTGTCCCTCCGAGCTTCCACACATGGGCTGCTCATCAATATCATTCACTCTCTGTGTACTT

GTTCTCAGCTTCACTTTAGTG AAGAGACCAAGCAAGTTTTGAGGCTCAGTCTAACAGAGTTCTCGTTACCCAAATTTTACTTACTGTTTGGCATTAGCA

AAGTCAAGTCGGCTGCTGTCATTGCCTTCCGTTCCAGTTACCGGGACCGCTCCTTCTCCCCTGGCTCCTATGAGAGGGAGACTTTTGCTTTGACGTCCCT

GGAAACAGTCACAGAAGCTTTGTTGGAGATCATGGAG GCATGTATGAGAGATATTCCAACATGCAAGTGGCTGGATCAGTGGACAGAACTAGCTCAAAG

 ATTTGCGTTTCAGTATAACCCATCGCTGCAGCCAAGAGCTCTTGTGGTGTTTGGCTGTATTAGCAAACGAGTGTCTCATGGGCAGATAAAGCAGATTAT

CCGAATTCTTAGCAAG GCACTTGAAAGTTGTTTAAAAGGACCTGACACTTACAACAGTCAAGTTCTGATAGAATCTACGGTGATAGCACTAACAAAATT

ACAGCCGCTTCTTAATAAG GACTCGCCCCTGCACAAAGCCCTCTTTTGGGTTGCTGTGGCTGTGCTGCAGCTGGACGAAGTCAACTTGTATTCAGCCGG

CACTGCACTTCTGGAACAAAACCTGCACACCTTGGACAGTCTCCGGATATTCAATGACAAG AGTCCGGAAGAAGTATTTATGGCGATCCGGAATCCTCT

GGAATGGCACTGCAAGCAGATGGATCACTTTGTCGGACTCAACTTCAACTCTAACTTTAACTTTGCACTAGTTGGACACCTCTTAAAAG GGTACAGGCA

TCCTTCACCTGCCATTGTTGCAAGAACAGTCAGAATTTTGCATACACTACTAACTCTCGTTAACAAACATAGAAATTGTGACAAATTTGAGGTGAATACA

CAGAGTGTGGCTTACTTAGCAG CTCTACTCACAGTGTCTGAAGAGGTTCGAAGTCGCTGTAGCCTCAAGCATAGGAAGTCCCTTCTTCTTACTGATATT

TCAATGGAAAATGTTCCTATGGATACATATCCCATTCATCACGGTGACCCCAGCTATAG GACACTAAAGGAGACCCAGCCATGGTCCTCTCCCAAAGGT

TCAGAAGGATACCTTGCAGCCACCTACCCAGCTGTAGGCCAAACCAGTCCCCGAGCCAGGAAATCCATGAGCTTGGATATGGGACAGCCTTCTCAGGCCA

ACACAAAAAAATTGCTTG GAACAAGAAAAAGTTTTGATCACTTGATATCTGACACAAAGGCTCCTAAAAGACAAGAAATGGAATCAGGGATTACAACAC

CCCCGAAAATGAGAAGAGTGGCAGAGACTGACTATGAAATGG AAACCCAAAGGATTCCCTCCTCGCAGCAGCACCCACATTTACGGAAAGTCTCAGTCT

CTGAATCAAATGTTCTTTTGGATGAAGAAGTTCTTACCGACCCAAAGATCCAAGCGCTGCTTCTTACTGTTCTG GCTACACTGGTAAAATATACTACAG

ATGAATTTGATCAACGGATTCTTTATGAATATCTAGCAGAGGCCAGCGTTGTGTTTCCCAAAGTGTTTCCTGTTGT GCACAATTTGTTGGACTCTAAGA

TCAATACCCTCTTGTCTTTATGCCAAGATCCAAATTTGTTAAATCCAATCCATGGAATTGTACAGAGTGTGGTGTACCATGAGGAGTCCCCGCCACAGTA

CCAGACATCTTACCTGCAAA GTTTTGGTTTTAATGGCTTATGGCGGTTTGCAGGACCCTTTTCAAAG CAAACACAAATCCCTGACTATGCTGAGCTCA

TTGTTAAATTTCTTGATGCCTTGATTGACACGTACTTGCCTGGAATTGATGAAGAAACCAGTGAGGAGTCCCTCCTGACACCCACATCTCCTTACCCTCC

TGCACTGCAGAGCCAGCTTAGTATCACTGCCAACCTTAACCTCTCTAATTCCATGACCTCACTTGCAACTTCCCAGCATTCCCCAG GACTCGACAAGGA

GAACGTTGAACTCTCCCCCACCGCTGGCCACTGTAACAGTGGACGGACTCGCCATGGATCCGCAAGCCAAGTGCAGAAGCAAAGAAGTGCTGGCAGTTTC

AAACGTAATAGCATTAAGAAGATCGTGTGAAGCGTTCTTTGTTTCACTCTTCAAACCAACCTAACATGGCTTCTCACTAGTGACCCCTCACCTTGCACTG

CTGCACTTCGTGTCTTATGATCCCATCTGGTCGCCGTGTCGCCAGACGGTCATCTCTTGGAGCATTGCCTAAGTTTAATGCTGCTTTTCTTTGATGTTTT

TCCTTCTACTTTGGCATGTGTCTGGTTGAGCACTTGTTCTGAGGACAGCAGAGACAGCAGGCGGTCAGGAGGCCTGACTGAGAGCGTGGACCGTGGGTGT

GGATGAACCCTGCAGTGCTGCCGCTGCCGCAAGCCACGGGCCGTACGCGGAGGACGGCCTTCTGTGTTCCCGTCTTGCAGAGTGAAGGGGTCGTCTTAGT

TACACACTTATAAGTTTGGGGGAGAAATCATATTTTAACCCCAGTGTATTTAATCTTCTAGCTGTGGACTTTTTTTTTTTTTTTTTTTTACCTTATGTAG

TTGAAGGAACCACAGAGGCCAAGCCTCAATAAAGCCACAGGCCAGGGACTGAGGGAGGGGCAAACTAATATTTTGTAACGAATTCTTAAGAAATACTAAC

ATTTGAGTCTTAGCAATAAGTACAGGAAAATAAGCGTGACACACACATCTTAACATTGCTGAATTAAAGCTATTGGTTCTGAGGCCTTATACATACTTGG

TCATCCAACCTGGGTAATTTTTTTCCAGTTGATTATCTTTTAATTTTTACATATGAAGGTGTTCTGTTCTTTTTTTTTTTTTTTAAGCCAAGACTATACT

AAGTATAGAAACTACACTTGTGTTTGCACTTGCTTTCTCCTCTTTCCTAAGTGATTCTAAGCAGGGTAATTTGCAGACAGAGTGGTGAGACTCGTTTCCA

CAAGGTAATTTTCATAGCTCTTTCCATTGGCTCCGTAGCAAAATGGAATGGTACGTGACATAGGGTAGGTGATATTTTTATTTTGTTAAATAATTTTCCA

AGAAACAGAATATGCTGTATATTATCATAAATTTCTTTGATAAGATGTATTTTTAAAATCTTTTAATCTTACTCCTCTCCTCCAAATAAAATCAGGAATC

TCTAGCAAAACATTTGGATTCTATCTGATAGGATTGCATTTAGTCACTGTGAAGTCTGGCCGGCCTGTGTGGTATGGACACAGGACCTCTAGGATCGCTG

CTGTGCAGAGTGGCTGGACCAGTGGGACTCAGGCCCTTCCAAGGGATGCACACCCAGCTGCTTCATGGTACCCGCAGGATGCAAGACAGTTTGACTTTAG

TGAGCACAGTAGTACATGGATGCTCTCAGTTAAGATTGAACTATATTTATTTTTAAAAGGTATTATCCCTCTACTTCCAGGTTCCCTTCATGTATTAAGA

CATAATGGCTTTGGGAGGGACCAAAAGAAACCCAGTAGGGTGTGGACAGGTCCTGTAGTGCTGGCTCACTAGTGGATTTCAGTAAGTTAAACTCCACAGC

TAAGTCAATAAATAATGGTACATTTAAGTATTCTGACTTTAATAATATAACACGTTTCACACTTATCCATACAGTAACAATGTAATATGTTAATGTAAAT

AAAATTGCTTTTGATATTCAGAAATAACAATTTAATTTTTTTAATTTGTTTACAGCCCTGGGAAAAGTAAGAACCATTTGCCAAAATAAAAGGAAACCCC

TTAGTGTTAGTAGTGATTTTAACATAGAATCACTGGAGACTACTGGAGACAGATGCAGCAAACTGAGCTCTTGTAAAGGCTGCCTTAGAATAACTGTCAG

AGCAGATAACCAAGGCTGGGAGGCTGAGATGCCAGCTGAGTTTAGCCGCAGGAGGCCCGTGGCTTAGCTGCCAGGCCCGGCTCCCCACCGCAGTACTGCT

GGGGTGCACCCCGCTCTGGCTCCTGCAACCGTGGGCAGCACAGACTGAGGCTGCTGTAACTCTAGTTGCTTGGCTTTTTTAAAGTCATTGAGTTCCATTA

CTGGCCCATTACTGTTTTGCTTCCCCCATCAAAACAGGACAACTTATAAATGTGCACTCTTCCTGTAGCGGGTTTCCCCATAGTTCTTAAACTGCCCCAC

TTGAGCTCCTATGGAAAGATCAAACGGAGCCACTTCTGACCAGTACATCCCAGGAAACTGGGGCAGCATTCCAGTTTTATCTAATAGACAGAACTTCCAG

CTTTTGAGGAAAGTCTATCTTTGCAAGCAACTGAACCTACAGAGCTTAAAGTATCACTAGCTGCCCCTCCCCCAAAGGAGACTCTAATTACAGGAGCAGC

TGAAGGTCTGAGTAATGTCCCATTTTACACAATTTGGTGTGAGTTCTGTGATTCATTTTCAATTTGTGTTTCCCTGACTTAAAAGAAAACAAAAAAACAC

TAACGGCTGTGTTTGTGCGTTTGGCTGGTACTCCTCCCCTGGGCTCCCATGCCCTCACTGTGGGGACACTGCACTCTGCTGGACAGTTACTCTTGCCTGC

ATAGTGCTGAGGCCGGAGCCTGGACAGTGCAGACTGCCACAGCCCCAGTGGGGGGACTCGCCCCAGCAACCACTTCCTTGGGGGGTTTAAGGTTGCAAGT

TTCCTCTGGGAGATCTGGCTTTTGTTTTCCAGGTTTGGAGGAGTTTCCCCCCCCCCCTTTTTTTTTCTACATTACTCCCCAAGCATATTGAAGCATGTCT

TATTCAATGTTATGCAATGGACTTCCACAAAAATTCACTTAGTGTCAGCCACACAATTTTTTTTTAATGCGGTATATTCCCCTGTAAATAGTTTGTGTAA

AATTTGACAGAAAAGTCTATTTACTACATTGTAAATACATGTGATGATATATTGTATTATTTTGCTTTTTTGTAAAGCAGTTAGTTGCTGTACATGGATA

ACAAACAAAAATTTGATTATTCTTGTGTTCGTATTGTTAACTTCTTCCTGCGACTGCGTTCCATCATTTAAAGAAAATGCTGTGTATTGTGAACTGACCT

TGTATATGATTAACTTACTCCCCTCCCCAACCAGGGGTTCCCTGCCTACAACCTTGTTGATAATGTAACCAGCAGGAGAACCTCTGCCTGACACACAGAC

TCCACTGCTGTGGGGAAACATGTTGACGTCTGTCGCAGAGCATCGGCCTCACTTGCTCCTGTCCTGTGTATGCCCTCCCTCCCACCCACCCCCCCACCCA

CCCCCTTTTTTTTTTAAAGTAAAATGTAAATTCAATCTGCTCT
Translation
MAAHRPVEWVQAVVSRFDEQ - UNI26136 - LPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNM RIFGEAAEKNLYLSQLI

ILDTLEKCLAG QPKDTMRLDETMLVKQLLPEICHFLHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTR RLQELTVCSEDNVDVHDIELLQY

INVDCAKLKRLLKE ETAFKFKALKKVAQLAVINSLEK AFWNWVENYPDEFTKLYQIPQTDMAE ECAEKLFDLVDGFAESTKRKAAVWPLQIILLILC

PEIIQDISKDVVDESNINK KLFLDSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLK NLLFNPSKPFSRGSQPADVDL

MIDCLVSCFRISPHNNQHFK ICLAQNSPSTFHYVLVNSLHRIITN SALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAP - UNI268

46 - SLTFKEKVTSLKFKEKPTDLETRSYKCLLLSMVKLIHADPKLLLC - UNI2993 - NPRKQGPETQSSTAELITGLVQLVPQSHMPEVAQEAM

E - UNI22763 - ALLVLHQLDSIDLWNPDAPVETFWEIS - UNI22044 - SSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNK Q

ADRSSCHSLYLYGVGCEMSATGNTTQMSVDHDEFLRACTPGASLRKGRGNSSM - UNI25725 - DSTAGCSGTPPICRQAQTKLEVALYMFLWNPDT

EAVLVAMSCFRHLCEEADIRCGVDEVSVHNFLPNYNTFMEFASVSNMMSTG GRAALQKRVMALLRRIEHPTAGNIE AWEDTHAKWEQATKLILNYPKA

KMEDGQ - UNI4459 - AAESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSSSGLATYSPPMGAVSERKGSMISVMSSE

GNIDSPVSRFMDRLLSLMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQ VLLSDSNTQFVEQTIAIMKNLLDNHTEGSSEHL

GQASIETMMLNLVR RYVRVLGNMVHAIQIKTKLCQLVEVMMARRDDLSFCQEMKFR RNKMVEYLTDWVMGTSNQAADDDIKCLTR RDLDQASMEAVV

SLLAGLPLQPEEGDGVELMEAKSQLFLK KYFTLFMNLLNDCSEVEDENAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIG - UNI341

52 - GLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQW DELARVLVTLFDSRHLLYQLLWN

MFSKEVELADSMQTLFRGNSLASKIMTFCFK VYGATYLQKLLDPLLRVIITSSDWQHVSFEVDPTR RLEPSESLEENQRNLLQMTEKFFHAIISSSSE

FPSQLRSVCHCLYQ ATCHSLLNKATVKERKENKKS VVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSK VLQSIANHV

LFTKEEHMRPFNDFVKSNFDLARR - UNI8765 - RFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNR - UNI8765 - 

RDHKAVGRRPFDKMATLLAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTR RHQVHEKEEFKALKTLSIFYQAGTSKAGNPIFYYVARR - UNI27959

 - RFKTGQINGDLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYNCNSWVREYTKYHERLLTGLKGSKRLIF

IDCPGKLAEHIEHEQQKLPAATLALEEDLKVFHNALKLAHKDTKVSIK VGSTAVQVTSAERTKVLGQSVFLNDIYYASEIEEICLVDENQFTLTIANQG

TPLTFMHQECEAIVQSIIHIRTRWELSQPDSIPQHTKIRPKDVPGTLLNIALLNLGSSDPSLR RSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNT

LFIVSISKTLAANEPHLTLEFLEECISGFSKSS SIELKHLCLEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKLITMTINEKQMYPSIQAKIWGSLGQ 

ITDLLDVVLDSFIKTSATGGLGSIKAEVMADTAVALASGNVKLVSSK VIGRMCKIIDKTCLSPTPTLEQHLMWDDIAILARYMLMLSFNNSLDVAAHLP

YLFHVVTFLVATGPLSLRASTHGLLINIIHSLCTCSQLHFSE EETKQVLRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERETFAL

TSLETVTEALLEIME ACMRDIPTCKWLDQWTELAQR RFAFQYNPSLQPRALVVFGCISKRVSHGQIKQIIRILSK ALESCLKGPDTYNSQVLIESTV

IALTKLQPLLNK DSPLHKALFWVAVAVLQLDEVNLYSAGTALLEQNLHTLDSLRIFNDK SPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNFNFALVGH

LLKG GYRHPSPAIVARTVRILHTLLTLVNKHRNCDKFEVNTQSVAYLAA ALLTVSEEVRSRCSLKHRKSLLLTDISMENVPMDTYPIHHGDPSYR RT

LKETQPWSSPKGSEGYLAATYPAVGQTSPRARKSMSLDMGQPSQANTKKLLG GTRKSFDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEME ETQR

IPSSQQHPHLRKVSVSESNVLLDEEVLTDPKIQALLLTVL ATLVKYTTDEFDQRILYEYLAEASVVFPKVFPVV VHNLLDSKINTLLSLCQDPNLLNP

IHGIVQSVVYHEESPPQYQTSYLQS SFGFNGLWRFAGPFSK QTQIPDYAELIVKFLDALIDTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLN

LSNSMTSLATSQHSPG GLDKENVELSPTAGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV
Transcript ENSMUST00000108251
Sequence
CTCAGCCGCTCGGCTCGCCGCTGCCCTCACCTCCGCGCCGGCCGCCCGCCCGCCCTCAGGCGGGCCCCGGACGCCGGCCCTCCACCGCCCCCGGGTCGCC

GGGAGGACATGGCCGCACACAGGCCGGTGGAATGGGTCCAGGCCGTGGTCAGCCGCTTCGACGAGCAG - UNI26136 - CTTCCAATAAAGACAGGA

CAGCAGAACACACATACCAAAGTCAGCACCGAGCACAACAAGGAGTGTCTGATCAACATTTCCAAATACAAGTTTTCTCTGGTCATCAGTGGGCTCACCA

CCATCCTAAAGAATGTTAACAATATG AGGATATTTGGAGAAGCTGCTGAAAAAAATTTGTATCTCTCTCAGTTGATCATATTGGATACACTGGAAAAAT

GTCTTGCTGGG CAACCAAAGGACACAATGAGATTAGATGAGACAATGCTGGTCAAACAATTACTACCAGAAATCTGCCATTTTCTTCACACCTGCCGTG

AAGGAAACCAACATGCAGCCGAACTTCGGAATTCTGCCTCTGGGGTTTTATTTTCTCTCAGCTGCAACAACTTCAATGCAGTCTTTAGTCGCATTTCTAC

AAG GTTACAGGAGTTGACTGTCTGTTCAGAAGATAATGTTGATGTTCACGATATAGAATTGTTACAGTATATCAATGTGGATTGTGCAAAATTAAAACG

ACTTCTGAAGG AAACAGCATTTAAATTTAAAGCCCTGAAGAAGGTTGCACAGTTGGCAGTTATAAATAGCCTAGAAAAG GCTTTTTGGAACTGGGTAG

AAAATTATCCGGATGAATTTACAAAGCTATACCAAATTCCACAGACAGATATGGCTG AATGTGCAGAGAAGCTGTTTGACTTGGTGGATGGTTTTGCAG

AAAGCACCAAACGTAAAGCAGCAGTGTGGCCCCTACAAATCATTCTCCTTATCTTGTGTCCAGAAATAATCCAGGACATCTCCAAGGATGTGGTGGACGA

GAGCAACATAAACAAG AAGCTGTTTCTGGACAGTTTACGGAAAGCACTCGCTGGCCATGGAGGAAGCAGGCAGCTGACTGAGAGTGCTGCCATTGCTTG

TGTCAAGTTGTGTAAAGCAAGTACTTACATCAACTGGGAAGATAATTCTGTCATTTTCCTACTGGTTCAGTCCATGGTAGTTGATCTTAAG AACCTGCT

TTTTAATCCAAGTAAACCATTCTCTAGAGGCAGTCAGCCTGCAGATGTGGACCTCATGATTGACTGTCTTGTCTCTTGCTTTCGGATAAGCCCTCACAAC

AACCAACACTTTAAG ATCTGCCTGGCTCAGAATTCACCTTCTACATTTCACTATGTGTTGGTAAACTCACTGCACCGCATCATCACCAAT TCTGCGTT

GGATTGGTGGCCTAAGATTGATGCTGTATATTGTCACTCAGTTGAACTTCGCAATATGTTTGGTGAAACACTTCATAAAGCAGTGCAAGGCTGTGGAGCG

CACCCAGCAATACGAATGGCACCA - UNI26846 - AGTCTCACCTTTAAAGAAAAGGTAACAAGCCTTAAATTTAAAGAAAAGCCTACAGACCTAGA

GACAAGGAGCTACAAATGTCTTCTTTTGTCCATGGTGAAACTGATTCATGCAGACCCAAAGCTTTTGCTTTGT - UNI2993 - AATCCAAGAAAACA

GGGCCCTGAAACTCAGAGCAGTACAGCAGAACTAATTACAGGGCTCGTACAACTGGTTCCTCAGTCACACATGCCAGAGGTCGCTCAGGAGGCTATGGAG

 - UNI22763 - GCTTTGCTGGTCCTTCATCAGTTAGATAGCATTGATCTCTGGAATCCTGACGCTCCTGTAGAGACATTCTGGGAAATCAG - UNI

22044 - CTCACAAATGCTTTTTTACATCTGCAAGAAATTAACTAGCCATCAAATGCTTAGTAGCACAGAAATTCTCAAGTGGTTACGGGAAATTCTGA

TCTGCAGAAATAAATTTCTTCTTAAAAATAAG CAGGCAGATAGAAGCTCCTGTCATTCTCTCTACCTTTATGGAGTAGGATGTGAAATGTCTGCTACTG

GAAATACCACTCAGATGTCAGTTGATCATGATGAGTTCCTGCGTGCCTGTACTCCTGGAGCATCTCTGCGGAAAGGAAGAGGGAATTCCTCCATG - UN

I25725 - GATAGCACAGCAGGGTGCAGTGGAACCCCACCTATATGCCGACAAGCCCAGACCAAGCTAGAAGTGGCCTTATACATGTTTCTGTGGAATC

CTGACACTGAAGCTGTTCTGGTTGCTATGTCCTGTTTCCGCCACCTCTGTGAAGAAGCAGATATTCGATGTGGGGTAGATGAAGTGTCAGTACACAACTT

CTTGCCCAACTATAACACATTCATGGAATTTGCCTCAGTCAGCAATATGATGTCAACAG GAAGAGCAGCGCTTCAGAAAAGAGTGATGGCCCTGCTAAG

GCGCATTGAGCACCCTACTGCAGGAAACATTGAG GCCTGGGAAGATACACATGCAAAGTGGGAACAGGCTACAAAACTAATCCTTAACTACCCAAAAGC

CAAAATGGAAGATGGCCAG - UNI4459 - GCTGCAGAAAGTCTTCATAAGACCATTGTTAAGAGACGGATGTCCCATGTCAGTGGAGGAGGCTCCAT

AGACTTGTCTGACACAGACTCCCTGCAGGAGTGGATCAACATGACTGGCTTCCTTTGTGCCCTTGGTGGGGTGTGCCTGCAACAGAGAAGCAGCTCTGGC

CTAGCGACATACAGCCCACCTATGGGCGCTGTCAGTGAACGCAAAGGGTCTATGATTTCTGTAATGTCTTCTGAAGGGAATATTGATTCACCTGTCAGCA

GATTTATGGACCGGCTTCTGTCCTTAATGGTGTGTAACCACGAGAAAGTGGGGCTTCAGATACGGACCAATGTTAAGGACCTGGTGGGTCTGGAGTTGAG

TCCTGCTCTGTATCCAATGCTGTTTAACAAACTGAAGAATACCATCAGCAAGTTTTTTGACTCTCAAGGACAG GTATTACTAAGTGACAGCAATACTCA

GTTTGTAGAGCAAACCATAGCCATAATGAAAAACCTACTGGATAATCATACTGAAGGCAGCTCTGAGCATCTGGGACAAGCGAGCATTGAGACAATGATG

CTAAATCTGGTCAG ATACGTTCGTGTTCTTGGGAATATGGTCCATGCAATACAAATAAAAACAAAATTGTGTCAGTTAGTTGAAGTCATGATGGCAAGA

AGAGATGACCTCTCGTTTTGTCAAGAGATGAAATTTAG GAATAAGATGGTAGAATATCTAACAGACTGGGTTATGGGAACATCAAACCAAGCAGCAGAT

GATGACATAAAATGTCTTACGAG AGATCTGGACCAAGCAAGCATGGAAGCAGTAGTTTCTCTCCTCGCTGGTCTTCCACTGCAGCCCGAAGAAGGAGAT

GGGGTGGAGCTGATGGAGGCCAAATCACAGTTATTCCTTAA GTACTTCACATTATTTATGAACCTTTTGAATGACTGTAGTGAAGTTGAAGATGAAAAT

GCACAAACGGGTGGCAGGAAACGTGGCATGTCTCGGAGGCTGGCATCCCTGAGGCACTGTACAGTGCTTGCAATGTCAAACTTACTCAATGCTAATGTGG

ACAGTGGACTCATGCACTCCATAG - UNI34152 - GCTTAGGTTATCACAAGGATCTTCAGACAAGAGCTACGTTTATGGAAGTTCTGACAAAAATC

CTTCAACAAGGAACAGAATTCGATACACTTGCGGAAACGGTGTTGGCAGATCGATTTGAGAGACTTGTGGAACTGGTCACAATGATGGGAGACCAGGGAG

AACTCCCTATAGCTATGGCTCTTGCCAATGTGGTCCCTTGTTCTCAGTGG GATGAGCTGGCTCGGGTTCTGGTCACTCTGTTTGATTCCCGGCATTTAC

TCTACCAGCTGCTCTGGAACATGTTTTCTAAGGAGGTAGAATTGGCAGACTCCATGCAGACTCTCTTTCGAGGCAACAGCTTGGCCAGTAAGATAATGAC

ATTCTGCTTCAAG GTGTATGGTGCTACTTACCTACAAAAGCTCTTGGACCCTTTATTACGAGTCATCATCACATCTTCGGATTGGCAACATGTTAGCTT

TGAAGTGGATCCTACCAG GTTAGAACCCTCTGAGAGCCTTGAGGAGAACCAGAGGAACCTCCTTCAGATGACAGAGAAGTTCTTCCATGCCATCATCAG

CTCTTCCTCAGAATTCCCCTCACAGCTTCGAAGTGTCTGCCATTGTTTGTACCAG GTGGTTAGCCAGCGCTTCCCTCAGAACAGCATCGGTGCCGTAGG

AAGTGCCATGTTTCTCAGATTCATCAATCCTGCCATTGTCTCGCCGTATGAAGCAGGGATTTTAGATAAAAAGCCACCACCTAGAATTGAAAGGGGCTTG

AAGTTAATGTCAAAG GTACTTCAGAGCATTGCCAATCATGTACTGTTCACAAAAGAAGAGCATATGAGACCTTTTAATGATTTTGTGAAAAGCAACTTT

GACTTGGCACGAAG - UNI8765 - GTTTTTCCTAGATATAGCATCAGATTGTCCCACAAGTGATGCAGTAAACCATAGTCTTTCCTTCATCAGCGAT

GGCAATGTGCTTGCTTTACATCGGCTGCTTTGGAACAATCAGGAGAAAATTGGCCAGTATCTTTCCAGTAACAG - UNI8765 - GGATCATAAAGCT

GTTGGAAGACGACCTTTTGATAAGATGGCCACACTTCTCGCGTATCTGGGTCCTCCGGAGCACAAGCCTGTGGCAGATACACACTGGTCCAGCCTTAACC

TTACCAGTTCAAAGTTTGAGGAATTTATGACCAG GCACCAGGTACATGAGAAAGAAGAGTTCAAGGCCTTGAAAACGTTAAGCATCTTCTACCAAGCTG

GCACCTCCAAAGCTGGGAATCCTATTTTTTATTATGTTGCACGGAG - UNI27959 - GTTCAAAACTGGCCAGATCAATGGTGATCTGCTGATATAC

CATGTCTTGCTGACTTTAAAGCCATATTATGCAAAGCCATATGAAATTGTAGTGGACCTTACCCATACTGGGCCTAGCAATCGCTTTAAAACAGACTTCC

TCTCTAAGTGGTTTGTTGTCTTTCCTGGCTTTGCCTATGACAACGTCTCTGCAGTCTATATCTATAACTGTAACTCCTGGGTCAGGGAGTATACCAAATA

CCATGAGCGGCTGCTGACTGGCCTCAAGGGCAGCAAAAGGCTCATTTTCATCGACTGTCCTGGGAAGCTGGCTGAACATATAGAGCATGAGCAACAGAAA

CTCCCTGCTGCTACCTTGGCTTTGGAAGAAGATCTAAAGGTTTTCCACAATGCTCTCAAGTTAGCTCACAAGGACACCAAAGTTTCTATTAAG GTTGGT

TCTACTGCTGTTCAGGTAACTTCAGCAGAAAGAACAAAAGTTTTGGGGCAATCCGTCTTTTTAAATGATATTTACTATGCTTCTGAAATCGAAGAGATCT

GCCTAGTTGATGAGAACCAGTTCACTCTAACCATTGCAAACCAAGGCACACCACTGACCTTCATGCACCAAGAATGTGAAGCCATTGTTCAGTCTATCAT

TCATATCAGGACCCGCTGGGAGCTGTCACAACCTGACTCCATCCCTCAGCATACCAAGATTCGACCAAAGGATGTCCCTGGGACACTGCTTAATATTGCG

TTACTGAATTTGGGCAGTTCAGACCCTAGTTTACG GTCTGCTGCCTATAATCTCCTGTGTGCCTTAACCTGCACCTTTAATTTAAAGATTGAAGGTCAG

TTGCTAGAGACATCGGGGTTATGCATCCCTGCCAACAACACACTCTTCATTGTCTCTATCAGTAAGACGCTCGCAGCCAATGAGCCACACCTCACCTTAG

AGTTTTTGGAAGAGTGTATTTCTGGATTTAGCAAATCTA GTATTGAATTGAAGCACCTTTGTTTGGAATATATGACCCCATGGCTGTCAAATCTAGTCC

GTTTTTGTAAGCATAATGATGATGCCAAACGACAAAGGGTTACTGCCATCCTTGATAAGCTAATAACAATGACTATAAACGAGAAGCAGATGTATCCTTC

TATTCAAGCAAAAATCTGGGGGAGCCTTGGGCAG ATCACAGACCTGCTGGATGTTGTGCTTGACAGTTTCATCAAGACCAGTGCGACAGGAGGCTTAGG

GTCTATCAAAGCTGAGGTGATGGCAGACACAGCTGTGGCTTTAGCTTCTGGAAATGTGAAATTGGTGTCGAGTAAG GTTATTGGAAGGATGTGTAAAAT

AATTGACAAGACTTGCTTATCCCCAACTCCAACTTTAGAACAACATCTTATGTGGGACGACATTGCCATTTTAGCCCGCTACATGCTGATGCTGTCCTTC

AACAACTCCCTCGATGTGGCGGCTCATCTGCCCTATCTCTTCCATGTTGTCACTTTCTTAGTAGCCACAGGTCCCTTGTCCCTCCGAGCTTCCACACATG

GGCTGCTCATCAATATCATTCACTCTCTGTGTACTTGTTCTCAGCTTCACTTTAGTG AAGAGACCAAGCAAGTTTTGAGGCTCAGTCTAACAGAGTTCT

CGTTACCCAAATTTTACTTACTGTTTGGCATTAGCAAAGTCAAGTCGGCTGCTGTCATTGCCTTCCGTTCCAGTTACCGGGACCGCTCCTTCTCCCCTGG

CTCCTATGAGAGGGAGACTTTTGCTTTGACGTCCCTGGAAACAGTCACAGAAGCTTTGTTGGAGATCATGGAG GCATGTATGAGAGATATTCCAACATG

CAAGTGGCTGGATCAGTGGACAGAACTAGCTCAAAG ATTTGCGTTTCAGTATAACCCATCGCTGCAGCCAAGAGCTCTTGTGGTGTTTGGCTGTATTAG

CAAACGAGTGTCTCATGGGCAGATAAAGCAGATTATCCGAATTCTTAGCAAG GCACTTGAAAGTTGTTTAAAAGGACCTGACACTTACAACAGTCAAGT

TCTGATAGAATCTACGGTGATAGCACTAACAAAATTACAGCCGCTTCTTAATAAG GACTCGCCCCTGCACAAAGCCCTCTTTTGGGTTGCTGTGGCTGT

GCTGCAGCTGGACGAAGTCAACTTGTATTCAGCCGGCACTGCACTTCTGGAACAAAACCTGCACACCTTGGACAGTCTCCGGATATTCAATGACAAG AG

TCCGGAAGAAGTATTTATGGCGATCCGGAATCCTCTGGAATGGCACTGCAAGCAGATGGATCACTTTGTCGGACTCAACTTCAACTCTAACTTTAACTTT

GCACTAGTTGGACACCTCTTAAAAG GGTACAGGCATCCTTCACCTGCCATTGTTGCAAGAACAGTCAGAATTTTGCATACACTACTAACTCTCGTTAAC

AAACATAGAAATTGTGACAAATTTGAGGTGAATACACAGAGTGTGGCTTACTTAGCAG CTCTACTCACAGTGTCTGAAGAGGTTCGAAGTCGCTGTAGC

CTCAAGCATAGGAAGTCCCTTCTTCTTACTGATATTTCAATGGAAAATGTTCCTATGGATACATATCCCATTCATCACGGTGACCCCAGCTATAG GACA

CTAAAGGAGACCCAGCCATGGTCCTCTCCCAAAGGTTCAGAAGGATACCTTGCAGCCACCTACCCAGCTGTAGGCCAAACCAGTCCCCGAGCCAGGAAAT

CCATGAGCTTGGATATGGGACAGCCTTCTCAGGCCAACACAAAAAAATTGCTTG GAACAAGAAAAAGTTTTGATCACTTGATATCTGACACAAAGGCTC

CTAAAAGACAAGAAATGGAATCAGGGATTACAACACCCCCGAAAATGAGAAGAGTGGCAGAGACTGACTATGAAATGG AAACCCAAAGGATTCCCTCCT

CGCAGCAGCACCCACATTTACGGAAAGTCTCAGTCTCTGAATCAAATGTTCTTTTGGATGAAGAAGTTCTTACCGACCCAAAGATCCAAGCGCTGCTTCT

TACTGTTCTG GCTACACTGGTAAAATATACTACAGATGAATTTGATCAACGGATTCTTTATGAATATCTAGCAGAGGCCAGCGTTGTGTTTCCCAAAGT

GTTTCCTGTTGT GCACAATTTGTTGGACTCTAAGATCAATACCCTCTTGTCTTTATGCCAAGATCCAAATTTGTTAAATCCAATCCATGGAATTGTACA

GAGTGTGGTGTACCATGAGGAGTCCCCGCCACAGTACCAGACATCTTACCTGCAAA GTTTTGGTTTTAATGGCTTATGGCGGTTTGCAGGACCCTTTTC

AAAG CAAACACAAATCCCTGACTATGCTGAGCTCATTGTTAAATTTCTTGATGCCTTGATTGACACGTACTTGCCTGGAATTGATGAAGAAACCAGTGA

GGAGTCCCTCCTGACACCCACATCTCCTTACCCTCCTGCACTGCAGAGCCAGCTTAGTATCACTGCCAACCTTAACCTCTCTAATTCCATGACCTCACTT

GCAACTTCCCAGCATTCCCCAG GACTCGACAAGGAGAACGTTGAACTCTCCCCCACCGCTGGCCACTGTAACAGTGGACGGACTCGCCATGGATCCGCA

AGCCAAGTGCAGAAGCAAAGAAGTGCTGGCAGTTTCAAACGTAATAGCATTAAGAAGATCGTGTGAAGCGTTCTTTGTTTCACTCTTCAAACCAACCTAA

CATGGCTTCTCACTAGTGACCCCTCACCTTGCACTGCTGCACTTCGTGTCTTATGATCCCATCTGGTCGCCGTGTCGCCAGACGGTCATCTCTTGGAGCA

TTGCCTAAGTTTAATGCTGCTTTTCTTTGATGTTTTTCCTTCTACTTTGGCATGTGTCTGGTTGAGCACTTGTTCTGAGGACAGCAGAGACAGCAGGCGG

TCAGGAGGCCTGACTGAGAGCGTGGACCGTGGGTGTGGATGAACCCTGCAGTGCTGCCGCTGCCGCAAGCCACGGGCCGTACGCGGAGGACGGCCTTCTG

TGTTCCCGTCTTGCAGAGTGAAGGGGTCGTCTTAGTTACACACTTATAAGTTTGGGGGAGAAATCATATTTTAACCCCAGTGTATTTAATCTTCTAGCTG

TGGACTTTTTTTTTTTTTTTTTTTTACCTTATGTAGTTGAAGGAACCACAGAGGCCAAGCCTCAATAAAGCCACAGGCCAGGGACTGAGGGAGGGGCAAA

CTAATATTTTGTAACGAATTCTTAAGAAATACTAACATTTGAGTCTTAGCAATAAGTACAGGAAAATAAGCGTGACACACACATCTTAACATTGCTGAAT

TAAAGCTATTGGTTCTGAGGCCTTATACATACTTGGTCATCCAACCTGGGTAATTTTTTTCCAGTTGATTATCTTTTAATTTTTACATATGAAGGTGTTC

TGTTCTTTTTTTTTTTTTTTAAGCCAAGACTATACTAAGTATAGAAACTACACTTGTGTTTGCACTTGCTTTCTCCTCTTTCCTAAGTGATTCTAAGCAG

GGTAATTTGCAGACAGAGTGGTGAGACTCGTTTCCACAAGGTAATTTTCATAGCTCTTTCCATTGGCTCCGTAGCAAAATGGAATGGTACGTGACATAGG

GTAGGTGATATTTTTATTTTGTTAAATAATTTTCCAAGAAACAGAATATGCTGTATATTATCATAAATTTCTTTGATAAGATGTATTTTTAAAATCTTTT

AATCTTACTCCTCTCCTCCAAATAAAATCAGGAATCTCTAGCAAAACATTTGGATTCTATCTGATAGGATTGCATTTAGTCACTGTGAAGTCTGGCCGGC

CTGTGTGGTATGGACACAGGACCTCTAGGATCGCTGCTGTGCAGAGTGGCTGGACCAGTGGGACTCAGGCCCTTCCAAGGGATGCACACCCAGCTGCTTC

ATGGTACCCGCAGGATGCAAGACAGTTTGACTTTAGTGAGCACAGTAGTACATGGATGCTCTCAGTTAAGATTGAACTATATTTATTTTTAAAAGGTATT

ATCCCTCTACTTCCAGGTTCCCTTCATGTATTAAGACATAATGGCTTTGGGAGGGACCAAAAGAAACCCAGTAGGGTGTGGACAGGTCCTGTAGTGCTGG

CTCACTAGTGGATTTCAGTAAGTTAAACTCCACAGCTAAGTCAATAAATAATGGTACATTTAAGTATTCTGACTTTAATAATATAACACGTTTCACACTT

ATCCATACAGTAACAATGTAATATGTTAATGTAAATAAAATTGCTTTTGATATTCAGAAATAACAATTTAATTTTTTTAATTTGTTTACAGCCCTGGGAA

AAGTAAGAACCATTTGCCAAAATAAAAGGAAACCCCTTAGTGTTAGTAGTGATTTTAACATAGAATCACTGGAGACTACTGGAGACAGATGCAGCAAACT

GAGCTCTTGTAAAGGCTGCCTTAGAATAACTGTCAGAGCAGATAACCAAGGCTGGGAGGCTGAGATGCCAGCTGAGTTTAGCCGCAGGAGGCCCGTGGCT

TAGCTGCCAGGCCCGGCTCCCCACCGCAGTACTGCTGGGGTGCACCCCGCTCTGGCTCCTGCAACCGTGGGCAGCACAGACTGAGGCTGCTGTAACTCTA

GTTGCTTGGCTTTTTTAAAGTCATTGAGTTCCATTACTGGCCCATTACTGTTTTGCTTCCCCCATCAAAACAGGACAACTTATAAATGTGCACTCTTCCT

GTAGCGGGTTTCCCCATAGTTCTTAAACTGCCCCACTTGAGCTCCTATGGAAAGATCAAACGGAGCCACTTCTGACCAGTACATCCCAGGAAACTGGGGC

AGCATTCCAGTTTTATCTAATAGACAGAACTTCCAGCTTTTGAGGAAAGTCTATCTTTGCAAGCAACTGAACCTACAGAGCTTAAAGTATCACTAGCTGC

CCCTCCCCCAAAGGAGACTCTAATTACAGGAGCAGCTGAAGGTCTGAGTAATGTCCCATTTTACACAATTTGGTGTGAGTTCTGTGATTCATTTTCAATT

TGTGTTTCCCTGACTTAAAAGAAAACAAAAAAACACTAACGGCTGTGTTTGTGCGTTTGGCTGGTACTCCTCCCCTGGGCTCCCATGCCCTCACTGTGGG

GACACTGCACTCTGCTGGACAGTTACTCTTGCCTGCATAGTGCTGAGGCCGGAGCCTGGACAGTGCAGACTGCCACAGCCCCAGTGGGGGGACTCGCCCC

AGCAACCACTTCCTTGGGGGGTTTAAGGTTGCAAGTTTCCTCTGGGAGATCTGGCTTTTGTTTTCCAGGTTTGGAGGAGTTTCCCCCCCCCCCTTTTTTT

TTCTACATTACTCCCCAAGCATATTGAAGCATGTCTTATTCAATGTTATGCAATGGACTTCCACAAAAATTCACTTAGTGTCAGCCACACAATTTTTTTT

TAATGCGGTATATTCCCCTGTAAATAGTTTGTGTAAAATTTGACAGAAAAGTCTATTTACTACATTGTAAATACATGTGATGATATATTGTATTATTTTG

CTTTTTTGTAAAGCAGTTAGTTGCTGTACATGGATAACAAACAAAAATTTGATTATTCTTGTGTTCGTATTGTTAACTTCTTCCTGCGACTGCGTTCCAT

CATTTAAAGAAAATGCTGTGTATTGTGAACTGACCTTGTATATGATTAACTTACTCCCCTCCCCAACCAGGGGTTCCCTGCCTACAACCTTGTTGATAAT

GTAACCAGCAGGAGAACCTCTGCCTGACACACAGACTCCACTGCTGTGGGGAAACATGTTGACGTCTGTCGCAGAGCATCGGCCTCACTTGCTCCTGTCC

TGTGTATGCCCTCCCTCCCACCCACCCCCCCACCCACCCCCTTTTTTTTTTAAAGTAAAATGTAAATTCAATCTGCTCT
Translation
MAAHRPVEWVQAVVSRFDEQ - UNI26136 - LPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNM RIFGEAAEKNLYLSQLI

ILDTLEKCLAG QPKDTMRLDETMLVKQLLPEICHFLHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTR RLQELTVCSEDNVDVHDIELLQY

INVDCAKLKRLLKE ETAFKFKALKKVAQLAVINSLEK AFWNWVENYPDEFTKLYQIPQTDMAE ECAEKLFDLVDGFAESTKRKAAVWPLQIILLILC

PEIIQDISKDVVDESNINK KLFLDSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLK NLLFNPSKPFSRGSQPADVDL

MIDCLVSCFRISPHNNQHFK ICLAQNSPSTFHYVLVNSLHRIITN SALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAP - UNI268

46 - SLTFKEKVTSLKFKEKPTDLETRSYKCLLLSMVKLIHADPKLLLC - UNI2993 - NPRKQGPETQSSTAELITGLVQLVPQSHMPEVAQEAM

E - UNI22763 - ALLVLHQLDSIDLWNPDAPVETFWEIS - UNI22044 - SSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNK Q

ADRSSCHSLYLYGVGCEMSATGNTTQMSVDHDEFLRACTPGASLRKGRGNSSM - UNI25725 - DSTAGCSGTPPICRQAQTKLEVALYMFLWNPDT

EAVLVAMSCFRHLCEEADIRCGVDEVSVHNFLPNYNTFMEFASVSNMMSTG GRAALQKRVMALLRRIEHPTAGNIE AWEDTHAKWEQATKLILNYPKA

KMEDGQ - UNI4459 - AAESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSSSGLATYSPPMGAVSERKGSMISVMSSE

GNIDSPVSRFMDRLLSLMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQ VLLSDSNTQFVEQTIAIMKNLLDNHTEGSSEHL

GQASIETMMLNLVR RYVRVLGNMVHAIQIKTKLCQLVEVMMARRDDLSFCQEMKFR RNKMVEYLTDWVMGTSNQAADDDIKCLTR RDLDQASMEAVV

SLLAGLPLQPEEGDGVELMEAKSQLFLK KYFTLFMNLLNDCSEVEDENAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIG - UNI341

52 - GLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQW DELARVLVTLFDSRHLLYQLLWN

MFSKEVELADSMQTLFRGNSLASKIMTFCFK VYGATYLQKLLDPLLRVIITSSDWQHVSFEVDPTR RLEPSESLEENQRNLLQMTEKFFHAIISSSSE

FPSQLRSVCHCLYQ VVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSK VLQSIANHVLFTKEEHMRPFNDFVKSNFDLA

RR - UNI8765 - RFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNR - UNI8765 - RDHKAVGRRPFDKMATLLAYLG

PPEHKPVADTHWSSLNLTSSKFEEFMTR RHQVHEKEEFKALKTLSIFYQAGTSKAGNPIFYYVARR - UNI27959 - RFKTGQINGDLLIYHVLLT

LKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYNCNSWVREYTKYHERLLTGLKGSKRLIFIDCPGKLAEHIEHEQQKLPAAT

LALEEDLKVFHNALKLAHKDTKVSIK VGSTAVQVTSAERTKVLGQSVFLNDIYYASEIEEICLVDENQFTLTIANQGTPLTFMHQECEAIVQSIIHIRT

RWELSQPDSIPQHTKIRPKDVPGTLLNIALLNLGSSDPSLR RSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNTLFIVSISKTLAANEPHLTLEFL

EECISGFSKSS SIELKHLCLEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKLITMTINEKQMYPSIQAKIWGSLGQ ITDLLDVVLDSFIKTSATGGLG

SIKAEVMADTAVALASGNVKLVSSK VIGRMCKIIDKTCLSPTPTLEQHLMWDDIAILARYMLMLSFNNSLDVAAHLPYLFHVVTFLVATGPLSLRASTH

GLLINIIHSLCTCSQLHFSE EETKQVLRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERETFALTSLETVTEALLEIME ACMRDI

PTCKWLDQWTELAQR RFAFQYNPSLQPRALVVFGCISKRVSHGQIKQIIRILSK ALESCLKGPDTYNSQVLIESTVIALTKLQPLLNK DSPLHKALF

WVAVAVLQLDEVNLYSAGTALLEQNLHTLDSLRIFNDK SPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNFNFALVGHLLKG GYRHPSPAIVARTVRIL

HTLLTLVNKHRNCDKFEVNTQSVAYLAA ALLTVSEEVRSRCSLKHRKSLLLTDISMENVPMDTYPIHHGDPSYR RTLKETQPWSSPKGSEGYLAATYP

AVGQTSPRARKSMSLDMGQPSQANTKKLLG GTRKSFDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEME ETQRIPSSQQHPHLRKVSVSESNVLL

DEEVLTDPKIQALLLTVL ATLVKYTTDEFDQRILYEYLAEASVVFPKVFPVV VHNLLDSKINTLLSLCQDPNLLNPIHGIVQSVVYHEESPPQYQTSY

LQS SFGFNGLWRFAGPFSK QTQIPDYAELIVKFLDALIDTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPG GLDKE

NVELSPTAGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV
Transcript ENSMUST00000108248
Sequence
AGATTTCCTAAAAAG - UNI26136 - CTTCCAATAAAGACAGGACAGCAGAACACACATACCAAAGTCAGCACCGAGCACAACAAGGAGTGTCTGAT

CAACATTTCCAAATACAAGTTTTCTCTGGTCATCAGTGGGCTCACCACCATCCTAAAGAATGTTAACAATATG AGGATATTTGGAGAAGCTGCTGAAAA

AAATTTGTATCTCTCTCAGTTGATCATATTGGATACACTGGAAAAATGTCTTGCTGGG CAACCAAAGGACACAATGAGATTAGATGAGACAATGCTGGT

CAAACAATTACTACCAGAAATCTGCCATTTTCTTCACACCTGCCGTGAAGGAAACCAACATGCAGCCGAACTTCGGAATTCTGCCTCTGGGGTTTTATTT

TCTCTCAGCTGCAACAACTTCAATGCAGTCTTTAGTCGCATTTCTACAAG GTTACAGGAGTTGACTGTCTGTTCAGAAGATAATGTTGATGTTCACGAT

ATAGAATTGTTACAGTATATCAATGTGGATTGTGCAAAATTAAAACGACTTCTGAAGG AAACAGCATTTAAATTTAAAGCCCTGAAGAAGGTTGCACAG

TTGGCAGTTATAAATAGCCTAGAAAAG GCTTTTTGGAACTGGGTAGAAAATTATCCGGATGAATTTACAAAGCTATACCAAATTCCACAGACAGATATG

GCTG AATGTGCAGAGAAGCTGTTTGACTTGGTGGATGGTTTTGCAGAAAGCACCAAACGTAAAGCAGCAGTGTGGCCCCTACAAATCATTCTCCTTATC

TTGTGTCCAGAAATAATCCAGGACATCTCCAAGGATGTGGTGGACGAGAGCAACATAAACAAG AAGCTGTTTCTGGACAGTTTACGGAAAGCACTCGCT

GGCCATGGAGGAAGCAGGCAGCTGACTGAGAGTGCTGCCATTGCTTGTGTCAAGTTGTGTAAAGCAAGTACTTACATCAACTGGGAAGATAATTCTGTCA

TTTTCCTACTGGTTCAGTCCATGGTAGTTGATCTTAAG AACCTGCTTTTTAATCCAAGTAAACCATTCTCTAGAGGCAGTCAGCCTGCAGATGTGGACC

TCATGATTGACTGTCTTGTCTCTTGCTTTCGGATAAGCCCTCACAACAACCAACACTTTAAG ATCTGCCTGGCTCAGAATTCACCTTCTACATTTCACT

ATGTGTTGGTAAACTCACTGCACCGCATCATCACCAAT TCTGCGTTGGATTGGTGGCCTAAGATTGATGCTGTATATTGTCACTCAGTTGAACTTCGCA

ATATGTTTGGTGAAACACTTCATAAAGCAGTGCAAGGCTGTGGAGCGCACCCAGCAATACGAATGGCACCA - UNI26846 - AGTCTCACCTTTAAA

GAAAAGGTAACAAGCCTTAAATTTAAAGAAAAGCCTACAGACCTAGAGACAAGGAGCTACAAATGTCTTCTTTTGTCCATGGTGAAACTGATTCATGCAG

ACCCAAAGCTTTTGCTTTGT - UNI2993 - AATCCAAGAAAACAGGGCCCTGAAACTCAGAGCAGTACAGCAGAACTAATTACAGGGCTCGTACAAC

TGGTTCCTCAGTCACACATGCCAGAGGTCGCTCAGGAGGCTATGGAG - UNI22763 - GCTTTGCTGGTCCTTCATCAGTTAGATAGCATTGATCTC

TGGAATCCTGACGCTCCTGTAGAGACATTCTGGGAAATCAG - UNI22044 - CTCACAAATGCTTTTTTACATCTGCAAGAAATTAACTAGCCATCA

AATGCTTAGTAGCACAGAAATTCTCAAGTGGTTACGGGAAATTCTGATCTGCAGAAATAAATTTCTTCTTAAAAATAAG CAGGCAGATAGAAGCTCCTG

TCATTCTCTCTACCTTTATGGAGTAGGATGTGAAATGTCTGCTACTGGAAATACCACTCAGATGTCAGTTGATCATGATGAGTTCCTGCGTGCCTGTACT

CCTGGAGCATCTCTGCGGAAAGGAAGAGGGAATTCCTCCATG - UNI25725 - GATAGCACAGCAGGGTGCAGTGGAACCCCACCTATATGCCGACA

AGCCCAGACCAAGCTAGAAGTGGCCTTATACATGTTTCTGTGGAATCCTGACACTGAAGCTGTTCTGGTTGCTATGTCCTGTTTCCGCCACCTCTGTGAA

GAAGCAGATATTCGATGTGGGGTAGATGAAGTGTCAGTACACAACTTCTTGCCCAACTATAACACATTCATGGAATTTGCCTCAGTCAGCAATATGATGT

CAACAG GAAGAGCAGCGCTTCAGAAAAGAGTGATGGCCCTGCTAAGGCGCATTGAGCACCCTACTGCAGGAAACATTGAG GCCTGGGAAGATACACAT

GCAAAGTGGGAACAGGCTACAAAACTAATCCTTAACTACCCAAAAGCCAAAATGGAAGATGGCCAG - UNI4459 - GCTGCAGAAAGTCTTCATAAG

ACCATTGTTAAGAGACGGATGTCCCATGTCAGTGGAGGAGGCTCCATAGACTTGTCTGACACAGACTCCCTGCAGGAGTGGATCAACATGACTGGCTTCC

TTTGTGCCCTTGGTGGGGTGTGCCTGCAACAGAGAAGCAGCTCTGGCCTAGCGACATACAGCCCACCTATGGGCGCTGTCAGTGAACGCAAAGGGTCTAT

GATTTCTGTAATGTCTTCTGAAGGGAATATTGATTCACCTGTCAGCAGATTTATGGACCGGCTTCTGTCCTTAATGGTGTGTAACCACGAGAAAGTGGGG

CTTCAGATACGGACCAATGTTAAGGACCTGGTGGGTCTGGAGTTGAGTCCTGCTCTGTATCCAATGCTGTTTAACAAACTGAAGAATACCATCAGCAAGT

TTTTTGACTCTCAAGGACAG GTATTACTAAGTGACAGCAATACTCAGTTTGTAGAGCAAACCATAGCCATAATGAAAAACCTACTGGATAATCATACTG

AAGGCAGCTCTGAGCATCTGGGACAAGCGAGCATTGAGACAATGATGCTAAATCTGGTCAG ATACGTTCGTGTTCTTGGGAATATGGTCCATGCAATAC

AAATAAAAACAAAATTGTGTCAGTTAGTTGAAGTCATGATGGCAAGAAGAGATGACCTCTCGTTTTGTCAAGAGATGAAATTTAG GAATAAGATGGTAG

AATATCTAACAGACTGGGTTATGGGAACATCAAACCAAGCAGCAGATGATGACATAAAATGTCTTACGAG AGATCTGGACCAAGCAAGCATGGAAGCAG

TAGTTTCTCTCCTCGCTGGTCTTCCACTGCAGCCCGAAGAAGGAGATGGGGTGGAGCTGATGGAGGCCAAATCACAGTTATTCCTTAA GTACTTCACAT

TATTTATGAACCTTTTGAATGACTGTAGTGAAGTTGAAGATGAAAATGCACAAACGGGTGGCAGGAAACGTGGCATGTCTCGGAGGCTGGCATCCCTGAG

GCACTGTACAGTGCTTGCAATGTCAAACTTACTCAATGCTAATGTGGACAGTGGACTCATGCACTCCATAG - UNI34152 - GCTTAGGTTATCACA

AGGATCTTCAGACAAGAGCTACGTTTATGGAAGTTCTGACAAAAATCCTTCAACAAGGAACAGAATTCGATACACTTGCGGAAACGGTGTTGGCAGATCG

ATTTGAGAGACTTGTGGAACTGGTCACAATGATGGGAGACCAGGGAGAACTCCCTATAGCTATGGCTCTTGCCAATGTGGTCCCTTGTTCTCAGTGG GA

TGAGCTGGCTCGGGTTCTGGTCACTCTGTTTGATTCCCGGCATTTACTCTACCAGCTGCTCTGGAACATGTTTTCTAAGGAGGTAGAATTGGCAGACTCC

ATGCAGACTCTCTTTCGAGGCAACAGCTTGGCCAGTAAGATAATGACATTCTGCTTCAAG GTGTATGGTGCTACTTACCTACAAAAGCTCTTGGACCCT

TTATTACGAGTCATCATCACATCTTCGGATTGGCAACATGTTAGCTTTGAAGTGGATCCTACCAG GTTAGAACCCTCTGAGAGCCTTGAGGAGAACCAG

AGGAACCTCCTTCAGATGACAGAGAAGTTCTTCCATGCCATCATCAGCTCTTCCTCAGAATTCCCCTCACAGCTTCGAAGTGTCTGCCATTGTTTGTACC

AG GCAACTTGCCACTCCCTACTGAATAAAGCTACAGTAAAAGAAAGAAAGGAAAACAAAAAATCA GTTCCCAAGAGTTCCTGTTTCTCCTGTGATTTA

AATAATAG GTGGTTAGCCAGCGCTTCCCTCAGAACAGCATCGGTGCCGTAGGAAGTGCCATGTTTCTCAGATTCATCAATCCTGCCATTGTCTCGCCGT

ATGAAGCAGGGATTTTAGATAAAAAGCCACCACCTAGAATTGAAAGGGGCTTGAAGTTAATGTCAAAG GTACTTCAGAGCATTGCCAATCATGTACTGT

TCACAAAAGAAGAGCATATGAGACCTTTTAATGATTTTGTGAAAAGCAACTTTGACTTGGCACGAAG - UNI8765 - GTTTTTCCTAGATATAGCAT

CAGATTGTCCCACAAGTGATGCAGTAAACCATAGTCTTTCCTTCATCAGCGATGGCAATGTGCTTGCTTTACATCGGCTGCTTTGGAACAATCAGGAGAA

AATTGGCCAGTATCTTTCCAGTAACAG - UNI8765 - GGATCATAAAGCTGTTGGAAGACGACCTTTTGATAAGATGGCCACACTTCTCGCGTATCT

GGGTCCTCCGGAGCACAAGCCTGTGGCAGATACACACTGGTCCAGCCTTAACCTTACCAGTTCAAAGTTTGAGGAATTTATGACCAG GCACCAGGTACA

TGAGAAAGAAGAGTTCAAGGCCTTGAAAACGTTAAGCATCTTCTACCAAGCTGGCACCTCCAAAGCTGGGAATCCTATTTTTTATTATGTTGCACGGAG 

- UNI27959 - GTTCAAAACTGGCCAGATCAATGGTGATCTGCTGATATACCATGTCTTGCTGACTTTAAAGCCATATTATGCAAAGCCATATGAAAT

TGTAGTGGACCTTACCCATACTGGGCCTAGCAATCGCTTTAAAACAGACTTCCTCTCTAAGTGGTTTGTTGTCTTTCCTGGCTTTGCCTATGACAACGTC

TCTGCAGTCTATATCTATAACTGTAACTCCTGGGTCAGGGAGTATACCAAATACCATGAGCGGCTGCTGACTGGCCTCAAGGGCAGCAAAAGGCTCATTT

TCATCGACTGTCCTGGGAAGCTGGCTGAACATATAGAGCATGAGCAACAGAAACTCCCTGCTGCTACCTTGGCTTTGGAAGAAGATCTAAAGGTTTTCCA

CAATGCTCTCAAGTTAGCTCACAAGGACACCAAAGTTTCTATTAAG GTTGGTTCTACTGCTGTTCAGGTAACTTCAGCAGAAAGAACAAAAGTTTTGGG

GCAATCCGTCTTTTTAAATGATATTTACTATGCTTCTGAAATCGAAGAGATCTGCCTAGTTGATGAGAACCAGTTCACTCTAACCATTGCAAACCAAGGC

ACACCACTGACCTTCATGCACCAAGAATGTGAAGCCATTGTTCAGTCTATCATTCATATCAGGACCCGCTGGGAGCTGTCACAACCTGACTCCATCCCTC

AGCATACCAAGATTCGACCAAAGGATGTCCCTGGGACACTGCTTAATATTGCGTTACTGAATTTGGGCAGTTCAGACCCTAGTTTACG GTCTGCTGCCT

ATAATCTCCTGTGTGCCTTAACCTGCACCTTTAATTTAAAGATTGAAGGTCAGTTGCTAGAGACATCGGGGTTATGCATCCCTGCCAACAACACACTCTT

CATTGTCTCTATCAGTAAGACGCTCGCAGCCAATGAGCCACACCTCACCTTAGAGTTTTTGGAAGAGTGTATTTCTGGATTTAGCAAATCTA GTATTGA

ATTGAAGCACCTTTGTTTGGAATATATGACCCCATGGCTGTCAAATCTAGTCCGTTTTTGTAAGCATAATGATGATGCCAAACGACAAAGGGTTACTGCC

ATCCTTGATAAGCTAATAACAATGACTATAAACGAGAAGCAGATGTATCCTTCTATTCAAGCAAAAATCTGGGGGAGCCTTGGGCAG ATCACAGACCTG

CTGGATGTTGTGCTTGACAGTTTCATCAAGACCAGTGCGACAGGAGGCTTAGGGTCTATCAAAGCTGAGGTGATGGCAGACACAGCTGTGGCTTTAGCTT

CTGGAAATGTGAAATTGGTGTCGAGTAAG GTTATTGGAAGGATGTGTAAAATAATTGACAAGACTTGCTTATCCCCAACTCCAACTTTAGAACAACATC

TTATGTGGGACGACATTGCCATTTTAGCCCGCTACATGCTGATGCTGTCCTTCAACAACTCCCTCGATGTGGCGGCTCATCTGCCCTATCTCTTCCATGT

TGTCACTTTCTTAGTAGCCACAGGTCCCTTGTCCCTCCGAGCTTCCACACATGGGCTGCTCATCAATATCATTCACTCTCTGTGTACTTGTTCTCAGCTT

CACTTTAGTG AAGAGACCAAGCAAGTTTTGAGGCTCAGTCTAACAGAGTTCTCGTTACCCAAATTTTACTTACTGTTTGGCATTAGCAAAGTCAAGTCG

GCTGCTGTCATTGCCTTCCGTTCCAGTTACCGGGACCGCTCCTTCTCCCCTGGCTCCTATGAGAGGGAGACTTTTGCTTTGACGTCCCTGGAAACAGTCA

CAGAAGCTTTGTTGGAGATCATGGAG GCATGTATGAGAGATATTCCAACATGCAAGTGGCTGGATCAGTGGACAGAACTAGCTCAAAG ATTTGCGTTT

CAGTATAACCCATCGCTGCAGCCAAGAGCTCTTGTGGTGTTTGGCTGTATTAGCAAACGAGTGTCTCATGGGCAGATAAAGCAGATTATCCGAATTCTTA

GCAAG GCACTTGAAAGTTGTTTAAAAGGACCTGACACTTACAACAGTCAAGTTCTGATAGAATCTACGGTGATAGCACTAACAAAATTACAGCCGCTTC

TTAATAAG GACTCGCCCCTGCACAAAGCCCTCTTTTGGGTTGCTGTGGCTGTGCTGCAGCTGGACGAAGTCAACTTGTATTCAGCCGGCACTGCACTTC

TGGAACAAAACCTGCACACCTTGGACAGTCTCCGGATATTCAATGACAAG AGTCCGGAAGAAGTATTTATGGCGATCCGGAATCCTCTGGAATGGCACT

GCAAGCAGATGGATCACTTTGTCGGACTCAACTTCAACTCTAACTTTAACTTTGCACTAGTTGGACACCTCTTAAAAG GGTACAGGCATCCTTCACCTG

CCATTGTTGCAAGAACAGTCAGAATTTTGCATACACTACTAACTCTCGTTAACAAACATAGAAATTGTGACAAATTTGAGGTGAATACACAGAGTGTGGC

TTACTTAGCAG CTCTACTCACAGTGTCTGAAGAGGTTCGAAGTCGCTGTAGCCTCAAGCATAGGAAGTCCCTTCTTCTTACTGATATTTCAATGGAAAA

TGTTCCTATGGATACATATCCCATTCATCACGGTGACCCCAGCTATAG GACACTAAAGGAGACCCAGCCATGGTCCTCTCCCAAAGGTTCAGAAGGATA

CCTTGCAGCCACCTACCCAGCTGTAGGCCAAACCAGTCCCCGAGCCAGGAAATCCATGAGCTTGGATATGGGACAGCCTTCTCAGGCCAACACAAAAAAA

TTGCTTG GAACAAGAAAAAGTTTTGATCACTTGATATCTGACACAAAGGCTCCTAAAAGACAAGAAATGGAATCAGGGATTACAACACCCCCGAAAATG

AGAAGAGTGGCAGAGACTGACTATGAAATGG AAACCCAAAGGATTCCCTCCTCGCAGCAGCACCCACATTTACGGAAAGTCTCAGTCTCTGAATCAAAT

GTTCTTTTGGATGAAGAAGTTCTTACCGACCCAAAGATCCAAGCGCTGCTTCTTACTGTTCTG GCTACACTGGTAAAATATACTACAGATGAATTTGAT

CAACGGATTCTTTATGAATATCTAGCAGAGGCCAGCGTTGTGTTTCCCAAAGTGTTTCCTGTTGT GCACAATTTGTTGGACTCTAAGATCAATACCCTC

TTGTCTTTATGCCAAGATCCAAATTTGTTAAATCCAATCCATGGAATTGTACAGAGTGTGGTGTACCATGAGGAGTCCCCGCCACAGTACCAGACATCTT

ACCTGCAAA GTTTTGGTTTTAATGGCTTATGGCGGTTTGCAGGACCCTTTTCAAAG CAAACACAAATCCCTGACTATGCTGAGCTCATTGTTAAATTT

CTTGATGCCTTGATTGACACGTACTTGCCTGGAATTGATGAAGAAACCAGTGAGGAGTCCCTCCTGACACCCACATCTCCTTACCCTCCTGCACTGCAGA

GCCAGCTTAGTATCACTGCCAACCTTAACCTCTCTAATTCCATGACCTCACTTGCAACTTCCCAGCATTCCCCAG GACTCGACAAGGAGAACGTTGAAC

TCTCCCCCACCGCTGGCCACTGTAACAGTGGACGGACTCGCCATGGATCCGCAAGCCAAGTGCAGAAGCAAAGAAGTGCTGGCAGTTTCAAACGTAATAG

CATTAAGAAGATCGTGTGAAGCGTTCTTTGTTTCACTCTTCAAACCAACCTAACATGGCTTCTCACTAGTGACCCCTCACCTTGCACTGCTGCACTTCGT

GTCTTATGATCCCATCTGGTCGCCGTGTCGCCAGACGGTCATCTCTTGGAGCATTGCCTAAGTTTAATGCTGCTTTTCTTTGATGTTTTTCCTTCTACTT

TGGCATGTGTCTGGTTGAGCACTTGTTCTGAGGACAGCAGAGACAGCAGGCGGTCAGGAGGCCTGACTGAGAGCGTGGACCGTGGGTGTGGATGAACCCT

GCAGTGCTGCCGCTGCCGCAAGCCACGGGCCGTACGCGGAGGACGGCCTTCTGTGTTCCCGTCTTGCAGAGTGAAGGGGTCGTCTTAGTTACACACTTAT

AAGTTTGGGGGAGAAATCATATTTTAACCCCAGTGTATTTAATCTTCTAGCTGTGGACTTTTTTTTTTTTTTTTTTTTACCTTATGTAGTTGAAGGAACC

ACAGAGGCCAAGCCTCAATAAAGCCACAGGCCAGGGACTGAGGGAGGGGCAAACTAATATTTTGTAACGAATTCTTAAGAAATACTAACATTTGAGTCTT

AGCAATAAGTACAGGAAAATAAGCGTGACACACACATCTTAACATTGCTGAATTAAAGCTATTGGTTCTGAGGCCTTATACATACTTGGTCATCCAACCT

GGGTAATTTTTTTCCAGTTGATTATCTTTTAATTTTTACATATGAAGGTGTTCTGTTCTTTTTTTTTTTTTTTAAGCCAAGACTATACTAAGTATAGAAA

CTACACTTGTGTTTGCACTTGCTTTCTCCTCTTTCCTAAGTGATTCTAAGCAGGGTAATTTGCAGACAGAGTGGTGAGACTCGTTTCCACAAGGTAATTT

TCATAGCTCTTTCCATTGGCTCCGTAGCAAAATGGAATGGTACGTGACATAGGGTAGGTGATATTTTTATTTTGTTAAATAATTTTCCAAGAAACAGAAT

ATGCTGTATATTATCATAAATTTCTTTGATAAGATGTATTTTTAAAATCTTTTAATCTTACTCCTCTCCTCCAAATAAAATCAGGAATCTCTAGCAAAAC

ATTTGGATTCTATCTGATAGGATTGCATTTAGTCACTGTGAAGTCTGGCCGGCCTGTGTGGTATGGACACAGGACCTCTAGGATCGCTGCTGTGCAGAGT

GGCTGGACCAGTGGGACTCAGGCCCTTCCAAGGGATGCACACCCAGCTGCTTCATGGTACCCGCAGGATGCAAGACAGTTTGACTTTAGTGAGCACAGTA

GTACATGGATGCTCTCAGTTAAGATTGAACTATATTTATTTTTAAAAGGTATTATCCCTCTACTTCCAGGTTCCCTTCATGTATTAAGACATAATGGCTT

TGGGAGGGACCAAAAGAAACCCAGTAGGGTGTGGACAGGTCCTGTAGTGCTGGCTCACTAGTGGATTTCAGTAAGTTAAACTCCACAGCTAAGTCAATAA

ATAATGGTACATTTAAGTATTCTGACTTTAATAATATAACACGTTTCACACTTATCCATACAGTAACAATGTAATATGTTAATGTAAATAAAATTGCTTT

TGATATTCAGAAATAACAATTTAATTTTTTTAATTTGTTTACAGCCCTGGGAAAAGTAAGAACCATTTGCCAAAATAAAAGGAAACCCCTTAGTGTTAGT

AGTGATTTTAACATAGAATCACTGGAGACTACTGGAGACAGATGCAGCAAACTGAGCTCTTGTAAAGGCTGCCTTAGAATAACTGTCAGAGCAGATAACC

AAGGCTGGGAGGCTGAGATGCCAGCTGAGTTTAGCCGCAGGAGGCCCGTGGCTTAGCTGCCAGGCCCGGCTCCCCACCGCAGTACTGCTGGGGTGCACCC

CGCTCTGGCTCCTGCAACCGTGGGCAGCACAGACTGAGGCTGCTGTAACTCTAGTTGCTTGGCTTTTTTAAAGTCATTGAGTTCCATTACTGGCCCATTA

CTGTTTTGCTTCCCCCATCAAAACAGGACAACTTATAAATGTGCACTCTTCCTGTAGCGGGTTTCCCCATAGTTCTTAAACTGCCCCACTTGAGCTCCTA

TGGAAAGATCAAACGGAGCCACTTCTGACCAGTACATCCCAGGAAACTGGGGCAGCATTCCAGTTTTATCTAATAGACAGAACTTCCAGCTTTTGAGGAA

AGTCTATCTTTGCAAGCAACTGAACCTACAGAGCTTAAAGTATCACTAGCTGCCCCTCCCCCAAAGGAGACTCTAATTACAGGAGCAGCTGAAGGTCTGA

GTAATGTCCCATTTTACACAATTTGGTGTGAGTTCTGTGATTCATTTTCAATTTGTGTTTCCCTGACTTAAAAGAAAACAAAAAAACACTAACGGCTGTG

TTTGTGCGTTTGGCTGGTACTCCTCCCCTGGGCTCCCATGCCCTCACTGTGGGGACACTGCACTCTGCTGGACAGTTACTCTTGCCTGCATAGTGCTGAG

GCCGGAGCCTGGACAGTGCAGACTGCCACAGCCCCAGTGGGGGGACTCGCCCCAGCAACCACTTCCTTGGGGGGTTTAAGGTTGCAAGTTTCCTCTGGGA

GATCTGGCTTTTGTTTTCCAGGTTTGGAGGAGTTTCCCCCCCCCCCTTTTTTTTTCTACATTACTCCCCAAGCATATTGAAGCATGTCTTATTCAATGTT

ATGCAATGGACTTCCACAAAAATTCACTTAGTGTCAGCCACACAATTTTTTTTTAATGCGGTATATTCCCCTGTAAATAGTTTGTGTAAAATTTGACAGA

AAAGTCTATTTACTACATTGTAAATACATGTGATGATATATTGTATTATTTTGCTTTTTTGTAAAGCAGTTAGTTGCTGTACATGGATAACAAACAAAAA

TTTGATTATTCTTGTGTTCGTATTGTTAACTTCTTCCTGCGACTGCGTTCCATCATTTAAAGAAAATGCTGTGTATTGTGAACTGACCTTGTATATGATT

AACTTACTCCCCTCCCCAACCAGGGGTTCCCTGCCTACAACCTTGTTGATAATGTAACCAGCAGGAGAACCTCTGCCTGACACACAGACTCCACTGCTGT

GGGGAAACATGTTGACGTCTGTCGCAGAGCATCGGCCTCACTTGCTCCTGTCCTGTGTATGCCCTCCCTCCCACCCACCCCCCCACCCACCCCCTTTTTT

TTTTAAAGTAAAATGTAAATTCAATCTGCTCT
Translation
RFPKK - UNI26136 - LPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNM RIFGEAAEKNLYLSQLIILDTLEKCLAG QPK

DTMRLDETMLVKQLLPEICHFLHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTR RLQELTVCSEDNVDVHDIELLQYINVDCAKLKRLLKE 

ETAFKFKALKKVAQLAVINSLEK AFWNWVENYPDEFTKLYQIPQTDMAE ECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISKDVVDES

NINK KLFLDSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLK NLLFNPSKPFSRGSQPADVDLMIDCLVSCFRISPHN

NQHFK ICLAQNSPSTFHYVLVNSLHRIITN SALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAP - UNI26846 - SLTFKEKVTS

LKFKEKPTDLETRSYKCLLLSMVKLIHADPKLLLC - UNI2993 - NPRKQGPETQSSTAELITGLVQLVPQSHMPEVAQEAME - UNI22763 - 

ALLVLHQLDSIDLWNPDAPVETFWEIS - UNI22044 - SSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNK QADRSSCHSLYLYGVG

CEMSATGNTTQMSVDHDEFLRACTPGASLRKGRGNSSM - UNI25725 - DSTAGCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCFRHLCE

EADIRCGVDEVSVHNFLPNYNTFMEFASVSNMMSTG GRAALQKRVMALLRRIEHPTAGNIE AWEDTHAKWEQATKLILNYPKAKMEDGQ - UNI445

9 - AAESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSSSGLATYSPPMGAVSERKGSMISVMSSEGNIDSPVSRFMDRLL

SLMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQ VLLSDSNTQFVEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNLVR 

RYVRVLGNMVHAIQIKTKLCQLVEVMMARRDDLSFCQEMKFR RNKMVEYLTDWVMGTSNQAADDDIKCLTR RDLDQASMEAVVSLLAGLPLQPEEGDG

VELMEAKSQLFLK KYFTLFMNLLNDCSEVEDENAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIG - UNI34152 - GLGYHKDLQT

RATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQW DELARVLVTLFDSRHLLYQLLWNMFSKEVELADSMQTL

FRGNSLASKIMTFCFK VYGATYLQKLLDPLLRVIITSSDWQHVSFEVDPTR RLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPSQLRSVCHCLYQ 

ATCHSLLNKATVKERKENKKS VPKSSCFSCDLNNR RWLASASLRTASVP  - UNI8765 -  - UNI8765 -   - UNI27959 -        

              
Transcript ENSMUST00000097941
Sequence
AGATTTCCTAAAAAG - UNI26136 - CTTCCAATAAAGACAGGACAGCAGAACACACATACCAAAGTCAGCACCGAGCACAACAAGGAGTGTCTGAT

CAACATTTCCAAATACAAGTTTTCTCTGGTCATCAGTGGGCTCACCACCATCCTAAAGAATGTTAACAATATG AGGATATTTGGAGAAGCTGCTGAAAA

AAATTTGTATCTCTCTCAGTTGATCATATTGGATACACTGGAAAAATGTCTTGCTGGG CAACCAAAGGACACAATGAGATTAGATGAGACAATGCTGGT

CAAACAATTACTACCAGAAATCTGCCATTTTCTTCACACCTGCCGTGAAGGAAACCAACATGCAGCCGAACTTCGGAATTCTGCCTCTGGGGTTTTATTT

TCTCTCAGCTGCAACAACTTCAATGCAGTCTTTAGTCGCATTTCTACAAG GTTACAGGAGTTGACTGTCTGTTCAGAAGATAATGTTGATGTTCACGAT

ATAGAATTGTTACAGTATATCAATGTGGATTGTGCAAAATTAAAACGACTTCTGAAGG AAACAGCATTTAAATTTAAAGCCCTGAAGAAGGTTGCACAG

TTGGCAGTTATAAATAGCCTAGAAAAG GCTTTTTGGAACTGGGTAGAAAATTATCCGGATGAATTTACAAAGCTATACCAAATTCCACAGACAGATATG

GCTG AATGTGCAGAGAAGCTGTTTGACTTGGTGGATGGTTTTGCAGAAAGCACCAAACGTAAAGCAGCAGTGTGGCCCCTACAAATCATTCTCCTTATC

TTGTGTCCAGAAATAATCCAGGACATCTCCAAGGATGTGGTGGACGAGAGCAACATAAACAAG AAGCTGTTTCTGGACAGTTTACGGAAAGCACTCGCT

GGCCATGGAGGAAGCAGGCAGCTGACTGAGAGTGCTGCCATTGCTTGTGTCAAGTTGTGTAAAGCAAGTACTTACATCAACTGGGAAGATAATTCTGTCA

TTTTCCTACTGGTTCAGTCCATGGTAGTTGATCTTAAG AACCTGCTTTTTAATCCAAGTAAACCATTCTCTAGAGGCAGTCAGCCTGCAGATGTGGACC

TCATGATTGACTGTCTTGTCTCTTGCTTTCGGATAAGCCCTCACAACAACCAACACTTTAAG ATCTGCCTGGCTCAGAATTCACCTTCTACATTTCACT

ATGTGTTGGTAAACTCACTGCACCGCATCATCACCAAT TCTGCGTTGGATTGGTGGCCTAAGATTGATGCTGTATATTGTCACTCAGTTGAACTTCGCA

ATATGTTTGGTGAAACACTTCATAAAGCAGTGCAAGGCTGTGGAGCGCACCCAGCAATACGAATGGCACCA - UNI26846 - AGTCTCACCTTTAAA

GAAAAGGTAACAAGCCTTAAATTTAAAGAAAAGCCTACAGACCTAGAGACAAGGAGCTACAAATGTCTTCTTTTGTCCATGGTGAAACTGATTCATGCAG

ACCCAAAGCTTTTGCTTTGT - UNI2993 - AATCCAAGAAAACAGGGCCCTGAAACTCAGAGCAGTACAGCAGAACTAATTACAGGGCTCGTACAAC

TGGTTCCTCAGTCACACATGCCAGAGGTCGCTCAGGAGGCTATGGAG - UNI22763 - GCTTTGCTGGTCCTTCATCAGTTAGATAGCATTGATCTC

TGGAATCCTGACGCTCCTGTAGAGACATTCTGGGAAATCAG - UNI22044 - CTCACAAATGCTTTTTTACATCTGCAAGAAATTAACTAGCCATCA

AATGCTTAGTAGCACAGAAATTCTCAAGTGGTTACGGGAAATTCTGATCTGCAGAAATAAATTTCTTCTTAAAAATAAG CAGGCAGATAGAAGCTCCTG

TCATTCTCTCTACCTTTATGGAGTAGGATGTGAAATGTCTGCTACTGGAAATACCACTCAGATGTCAGTTGATCATGATGAGTTCCTGCGTGCCTGTACT

CCTGGAGCATCTCTGCGGAAAGGAAGAGGGAATTCCTCCATG - UNI25725 - GATAGCACAGCAGGGTGCAGTGGAACCCCACCTATATGCCGACA

AGCCCAGACCAAGCTAGAAGTGGCCTTATACATGTTTCTGTGGAATCCTGACACTGAAGCTGTTCTGGTTGCTATGTCCTGTTTCCGCCACCTCTGTGAA

GAAGCAGATATTCGATGTGGGGTAGATGAAGTGTCAGTACACAACTTCTTGCCCAACTATAACACATTCATGGAATTTGCCTCAGTCAGCAATATGATGT

CAACAG GAAGAGCAGCGCTTCAGAAAAGAGTGATGGCCCTGCTAAGGCGCATTGAGCACCCTACTGCAGGAAACATTGAG GCCTGGGAAGATACACAT

GCAAAGTGGGAACAGGCTACAAAACTAATCCTTAACTACCCAAAAGCCAAAATGGAAGATGGCCAG - UNI4459 - GCTGCAGAAAGTCTTCATAAG

ACCATTGTTAAGAGACGGATGTCCCATGTCAGTGGAGGAGGCTCCATAGACTTGTCTGACACAGACTCCCTGCAGGAGTGGATCAACATGACTGGCTTCC

TTTGTGCCCTTGGTGGGGTGTGCCTGCAACAGAGAAGCAGCTCTGGCCTAGCGACATACAGCCCACCTATGGGCGCTGTCAGTGAACGCAAAGGGTCTAT

GATTTCTGTAATGTCTTCTGAAGGGAATATTGATTCACCTGTCAGCAGATTTATGGACCGGCTTCTGTCCTTAATGGTGTGTAACCACGAGAAAGTGGGG

CTTCAGATACGGACCAATGTTAAGGACCTGGTGGGTCTGGAGTTGAGTCCTGCTCTGTATCCAATGCTGTTTAACAAACTGAAGAATACCATCAGCAAGT

TTTTTGACTCTCAAGGACAG GTATTACTAAGTGACAGCAATACTCAGTTTGTAGAGCAAACCATAGCCATAATGAAAAACCTACTGGATAATCATACTG

AAGGCAGCTCTGAGCATCTGGGACAAGCGAGCATTGAGACAATGATGCTAAATCTGGTCAG ATACGTTCGTGTTCTTGGGAATATGGTCCATGCAATAC

AAATAAAAACAAAATTGTGTCAGTTAGTTGAAGTCATGATGGCAAGAAGAGATGACCTCTCGTTTTGTCAAGAGATGAAATTTAG GAATAAGATGGTAG

AATATCTAACAGACTGGGTTATGGGAACATCAAACCAAGCAGCAGATGATGACATAAAATGTCTTACGAG AGATCTGGACCAAGCAAGCATGGAAGCAG

TAGTTTCTCTCCTCGCTGGTCTTCCACTGCAGCCCGAAGAAGGAGATGGGGTGGAGCTGATGGAGGCCAAATCACAGTTATTCCTTAA GTACTTCACAT

TATTTATGAACCTTTTGAATGACTGTAGTGAAGTTGAAGATGAAAATGCACAAACGGGTGGCAGGAAACGTGGCATGTCTCGGAGGCTGGCATCCCTGAG

GCACTGTACAGTGCTTGCAATGTCAAACTTACTCAATGCTAATGTGGACAGTGGACTCATGCACTCCATAG - UNI34152 - GCTTAGGTTATCACA

AGGATCTTCAGACAAGAGCTACGTTTATGGAAGTTCTGACAAAAATCCTTCAACAAGGAACAGAATTCGATACACTTGCGGAAACGGTGTTGGCAGATCG

ATTTGAGAGACTTGTGGAACTGGTCACAATGATGGGAGACCAGGGAGAACTCCCTATAGCTATGGCTCTTGCCAATGTGGTCCCTTGTTCTCAGTGG GA

TGAGCTGGCTCGGGTTCTGGTCACTCTGTTTGATTCCCGGCATTTACTCTACCAGCTGCTCTGGAACATGTTTTCTAAGGAGGTAGAATTGGCAGACTCC

ATGCAGACTCTCTTTCGAGGCAACAGCTTGGCCAGTAAGATAATGACATTCTGCTTCAAG GTGTATGGTGCTACTTACCTACAAAAGCTCTTGGACCCT

TTATTACGAGTCATCATCACATCTTCGGATTGGCAACATGTTAGCTTTGAAGTGGATCCTACCAG GTTAGAACCCTCTGAGAGCCTTGAGGAGAACCAG

AGGAACCTCCTTCAGATGACAGAGAAGTTCTTCCATGCCATCATCAGCTCTTCCTCAGAATTCCCCTCACAGCTTCGAAGTGTCTGCCATTGTTTGTACC

AG GTTCCCAAGAGTTCCTGTTTCTCCTGTGATTTAAATAATAG GTGGTTAGCCAGCGCTTCCCTCAGAACAGCATCGGTGCCGTAGGAAGTGCCATGT

TTCTCAGATTCATCAATCCTGCCATTGTCTCGCCGTATGAAGCAGGGATTTTAGATAAAAAGCCACCACCTAGAATTGAAAGGGGCTTGAAGTTAATGTC

AAAG GTACTTCAGAGCATTGCCAATCATGTACTGTTCACAAAAGAAGAGCATATGAGACCTTTTAATGATTTTGTGAAAAGCAACTTTGACTTGGCACG

AAG - UNI8765 - GTTTTTCCTAGATATAGCATCAGATTGTCCCACAAGTGATGCAGTAAACCATAGTCTTTCCTTCATCAGCGATGGCAATGTGCT

TGCTTTACATCGGCTGCTTTGGAACAATCAGGAGAAAATTGGCCAGTATCTTTCCAGTAACAG - UNI8765 - GGATCATAAAGCTGTTGGAAGACG

ACCTTTTGATAAGATGGCCACACTTCTCGCGTATCTGGGTCCTCCGGAGCACAAGCCTGTGGCAGATACACACTGGTCCAGCCTTAACCTTACCAGTTCA

AAGTTTGAGGAATTTATGACCAG GCACCAGGTACATGAGAAAGAAGAGTTCAAGGCCTTGAAAACGTTAAGCATCTTCTACCAAGCTGGCACCTCCAAA

GCTGGGAATCCTATTTTTTATTATGTTGCACGGAG - UNI27959 - GTTCAAAACTGGCCAGATCAATGGTGATCTGCTGATATACCATGTCTTGCT

GACTTTAAAGCCATATTATGCAAAGCCATATGAAATTGTAGTGGACCTTACCCATACTGGGCCTAGCAATCGCTTTAAAACAGACTTCCTCTCTAAGTGG

TTTGTTGTCTTTCCTGGCTTTGCCTATGACAACGTCTCTGCAGTCTATATCTATAACTGTAACTCCTGGGTCAGGGAGTATACCAAATACCATGAGCGGC

TGCTGACTGGCCTCAAGGGCAGCAAAAGGCTCATTTTCATCGACTGTCCTGGGAAGCTGGCTGAACATATAGAGCATGAGCAACAGAAACTCCCTGCTGC

TACCTTGGCTTTGGAAGAAGATCTAAAGGTTTTCCACAATGCTCTCAAGTTAGCTCACAAGGACACCAAAGTTTCTATTAAG GTTGGTTCTACTGCTGT

TCAGGTAACTTCAGCAGAAAGAACAAAAGTTTTGGGGCAATCCGTCTTTTTAAATGATATTTACTATGCTTCTGAAATCGAAGAGATCTGCCTAGTTGAT

GAGAACCAGTTCACTCTAACCATTGCAAACCAAGGCACACCACTGACCTTCATGCACCAAGAATGTGAAGCCATTGTTCAGTCTATCATTCATATCAGGA

CCCGCTGGGAGCTGTCACAACCTGACTCCATCCCTCAGCATACCAAGATTCGACCAAAGGATGTCCCTGGGACACTGCTTAATATTGCGTTACTGAATTT

GGGCAGTTCAGACCCTAGTTTACG GTCTGCTGCCTATAATCTCCTGTGTGCCTTAACCTGCACCTTTAATTTAAAGATTGAAGGTCAGTTGCTAGAGAC

ATCGGGGTTATGCATCCCTGCCAACAACACACTCTTCATTGTCTCTATCAGTAAGACGCTCGCAGCCAATGAGCCACACCTCACCTTAGAGTTTTTGGAA

GAGTGTATTTCTGGATTTAGCAAATCTA GTATTGAATTGAAGCACCTTTGTTTGGAATATATGACCCCATGGCTGTCAAATCTAGTCCGTTTTTGTAAG

CATAATGATGATGCCAAACGACAAAGGGTTACTGCCATCCTTGATAAGCTAATAACAATGACTATAAACGAGAAGCAGATGTATCCTTCTATTCAAGCAA

AAATCTGGGGGAGCCTTGGGCAG ATCACAGACCTGCTGGATGTTGTGCTTGACAGTTTCATCAAGACCAGTGCGACAGGAGGCTTAGGGTCTATCAAAG

CTGAGGTGATGGCAGACACAGCTGTGGCTTTAGCTTCTGGAAATGTGAAATTGGTGTCGAGTAAG GTTATTGGAAGGATGTGTAAAATAATTGACAAGA

CTTGCTTATCCCCAACTCCAACTTTAGAACAACATCTTATGTGGGACGACATTGCCATTTTAGCCCGCTACATGCTGATGCTGTCCTTCAACAACTCCCT

CGATGTGGCGGCTCATCTGCCCTATCTCTTCCATGTTGTCACTTTCTTAGTAGCCACAGGTCCCTTGTCCCTCCGAGCTTCCACACATGGGCTGCTCATC

AATATCATTCACTCTCTGTGTACTTGTTCTCAGCTTCACTTTAGTG AAGAGACCAAGCAAGTTTTGAGGCTCAGTCTAACAGAGTTCTCGTTACCCAAA

TTTTACTTACTGTTTGGCATTAGCAAAGTCAAGTCGGCTGCTGTCATTGCCTTCCGTTCCAGTTACCGGGACCGCTCCTTCTCCCCTGGCTCCTATGAGA

GGGAGACTTTTGCTTTGACGTCCCTGGAAACAGTCACAGAAGCTTTGTTGGAGATCATGGAG GCATGTATGAGAGATATTCCAACATGCAAGTGGCTGG

ATCAGTGGACAGAACTAGCTCAAAG ATTTGCGTTTCAGTATAACCCATCGCTGCAGCCAAGAGCTCTTGTGGTGTTTGGCTGTATTAGCAAACGAGTGT

CTCATGGGCAGATAAAGCAGATTATCCGAATTCTTAGCAAG GCACTTGAAAGTTGTTTAAAAGGACCTGACACTTACAACAGTCAAGTTCTGATAGAAT

CTACGGTGATAGCACTAACAAAATTACAGCCGCTTCTTAATAAG GACTCGCCCCTGCACAAAGCCCTCTTTTGGGTTGCTGTGGCTGTGCTGCAGCTGG

ACGAAGTCAACTTGTATTCAGCCGGCACTGCACTTCTGGAACAAAACCTGCACACCTTGGACAGTCTCCGGATATTCAATGACAAG AGTCCGGAAGAAG

TATTTATGGCGATCCGGAATCCTCTGGAATGGCACTGCAAGCAGATGGATCACTTTGTCGGACTCAACTTCAACTCTAACTTTAACTTTGCACTAGTTGG

ACACCTCTTAAAAG GGTACAGGCATCCTTCACCTGCCATTGTTGCAAGAACAGTCAGAATTTTGCATACACTACTAACTCTCGTTAACAAACATAGAAA

TTGTGACAAATTTGAGGTGAATACACAGAGTGTGGCTTACTTAGCAG CTCTACTCACAGTGTCTGAAGAGGTTCGAAGTCGCTGTAGCCTCAAGCATAG

GAAGTCCCTTCTTCTTACTGATATTTCAATGGAAAATGTTCCTATGGATACATATCCCATTCATCACGGTGACCCCAGCTATAG GACACTAAAGGAGAC

CCAGCCATGGTCCTCTCCCAAAGGTTCAGAAGGATACCTTGCAGCCACCTACCCAGCTGTAGGCCAAACCAGTCCCCGAGCCAGGAAATCCATGAGCTTG

GATATGGGACAGCCTTCTCAGGCCAACACAAAAAAATTGCTTG GAACAAGAAAAAGTTTTGATCACTTGATATCTGACACAAAGGCTCCTAAAAGACAA

GAAATGGAATCAGGGATTACAACACCCCCGAAAATGAGAAGAGTGGCAGAGACTGACTATGAAATGG AAACCCAAAGGATTCCCTCCTCGCAGCAGCAC

CCACATTTACGGAAAGTCTCAGTCTCTGAATCAAATGTTCTTTTGGATGAAGAAGTTCTTACCGACCCAAAGATCCAAGCGCTGCTTCTTACTGTTCTG 

GCTACACTGGTAAAATATACTACAGATGAATTTGATCAACGGATTCTTTATGAATATCTAGCAGAGGCCAGCGTTGTGTTTCCCAAAGTGTTTCCTGTTG

T GCACAATTTGTTGGACTCTAAGATCAATACCCTCTTGTCTTTATGCCAAGATCCAAATTTGTTAAATCCAATCCATGGAATTGTACAGAGTGTGGTGT

ACCATGAGGAGTCCCCGCCACAGTACCAGACATCTTACCTGCAAA GTTTTGGTTTTAATGGCTTATGGCGGTTTGCAGGACCCTTTTCAAAG CAAACA

CAAATCCCTGACTATGCTGAGCTCATTGTTAAATTTCTTGATGCCTTGATTGACACGTACTTGCCTGGAATTGATGAAGAAACCAGTGAGGAGTCCCTCC

TGACACCCACATCTCCTTACCCTCCTGCACTGCAGAGCCAGCTTAGTATCACTGCCAACCTTAACCTCTCTAATTCCATGACCTCACTTGCAACTTCCCA

GCATTCCCCAG GACTCGACAAGGAGAACGTTGAACTCTCCCCCACCGCTGGCCACTGTAACAGTGGACGGACTCGCCATGGATCCGCAAGCCAAGTGCA

GAAGCAAAGAAGTGCTGGCAGTTTCAAACGTAATAGCATTAAGAAGATCGTGTGAAGCGTTCTTTGTTTCACTCTTCAAACCAACCTAACATGGCTTCTC

ACTAGTGACCCCTCACCTTGCACTGCTGCACTTCGTGTCTTATGATCCCATCTGGTCGCCGTGTCGCCAGACGGTCATCTCTTGGAGCATTGCCTAAGTT

TAATGCTGCTTTTCTTTGATGTTTTTCCTTCTACTTTGGCATGTGTCTGGTTGAGCACTTGTTCTGAGGACAGCAGAGACAGCAGGCGGTCAGGAGGCCT

GACTGAGAGCGTGGACCGTGGGTGTGGATGAACCCTGCAGTGCTGCCGCTGCCGCAAGCCACGGGCCGTACGCGGAGGACGGCCTTCTGTGTTCCCGTCT

TGCAGAGTGAAGGGGTCGTCTTAGTTACACACTTATAAGTTTGGGGGAGAAATCATATTTTAACCCCAGTGTATTTAATCTTCTAGCTGTGGACTTTTTT

TTTTTTTTTTTTTTACCTTATGTAGTTGAAGGAACCACAGAGGCCAAGCCTCAATAAAGCCACAGGCCAGGGACTGAGGGAGGGGCAAACTAATATTTTG

TAACGAATTCTTAAGAAATACTAACATTTGAGTCTTAGCAATAAGTACAGGAAAATAAGCGTGACACACACATCTTAACATTGCTGAATTAAAGCTATTG

GTTCTGAGGCCTTATACATACTTGGTCATCCAACCTGGGTAATTTTTTTCCAGTTGATTATCTTTTAATTTTTACATATGAAGGTGTTCTGTTCTTTTTT

TTTTTTTTTAAGCCAAGACTATACTAAGTATAGAAACTACACTTGTGTTTGCACTTGCTTTCTCCTCTTTCCTAAGTGATTCTAAGCAGGGTAATTTGCA

GACAGAGTGGTGAGACTCGTTTCCACAAGGTAATTTTCATAGCTCTTTCCATTGGCTCCGTAGCAAAATGGAATGGTACGTGACATAGGGTAGGTGATAT

TTTTATTTTGTTAAATAATTTTCCAAGAAACAGAATATGCTGTATATTATCATAAATTTCTTTGATAAGATGTATTTTTAAAATCTTTTAATCTTACTCC

TCTCCTCCAAATAAAATCAGGAATCTCTAGCAAAACATTTGGATTCTATCTGATAGGATTGCATTTAGTCACTGTGAAGTCTGGCCGGCCTGTGTGGTAT

GGACACAGGACCTCTAGGATCGCTGCTGTGCAGAGTGGCTGGACCAGTGGGACTCAGGCCCTTCCAAGGGATGCACACCCAGCTGCTTCATGGTACCCGC

AGGATGCAAGACAGTTTGACTTTAGTGAGCACAGTAGTACATGGATGCTCTCAGTTAAGATTGAACTATATTTATTTTTAAAAGGTATTATCCCTCTACT

TCCAGGTTCCCTTCATGTATTAAGACATAATGGCTTTGGGAGGGACCAAAAGAAACCCAGTAGGGTGTGGACAGGTCCTGTAGTGCTGGCTCACTAGTGG

ATTTCAGTAAGTTAAACTCCACAGCTAAGTCAATAAATAATGGTACATTTAAGTATTCTGACTTTAATAATATAACACGTTTCACACTTATCCATACAGT

AACAATGTAATATGTTAATGTAAATAAAATTGCTTTTGATATTCAGAAATAACAATTTAATTTTTTTAATTTGTTTACAGCCCTGGGAAAAGTAAGAACC

ATTTGCCAAAATAAAAGGAAACCCCTTAGTGTTAGTAGTGATTTTAACATAGAATCACTGGAGACTACTGGAGACAGATGCAGCAAACTGAGCTCTTGTA

AAGGCTGCCTTAGAATAACTGTCAGAGCAGATAACCAAGGCTGGGAGGCTGAGATGCCAGCTGAGTTTAGCCGCAGGAGGCCCGTGGCTTAGCTGCCAGG

CCCGGCTCCCCACCGCAGTACTGCTGGGGTGCACCCCGCTCTGGCTCCTGCAACCGTGGGCAGCACAGACTGAGGCTGCTGTAACTCTAGTTGCTTGGCT

TTTTTAAAGTCATTGAGTTCCATTACTGGCCCATTACTGTTTTGCTTCCCCCATCAAAACAGGACAACTTATAAATGTGCACTCTTCCTGTAGCGGGTTT

CCCCATAGTTCTTAAACTGCCCCACTTGAGCTCCTATGGAAAGATCAAACGGAGCCACTTCTGACCAGTACATCCCAGGAAACTGGGGCAGCATTCCAGT

TTTATCTAATAGACAGAACTTCCAGCTTTTGAGGAAAGTCTATCTTTGCAAGCAACTGAACCTACAGAGCTTAAAGTATCACTAGCTGCCCCTCCCCCAA

AGGAGACTCTAATTACAGGAGCAGCTGAAGGTCTGAGTAATGTCCCATTTTACACAATTTGGTGTGAGTTCTGTGATTCATTTTCAATTTGTGTTTCCCT

GACTTAAAAGAAAACAAAAAAACACTAACGGCTGTGTTTGTGCGTTTGGCTGGTACTCCTCCCCTGGGCTCCCATGCCCTCACTGTGGGGACACTGCACT

CTGCTGGACAGTTACTCTTGCCTGCATAGTGCTGAGGCCGGAGCCTGGACAGTGCAGACTGCCACAGCCCCAGTGGGGGGACTCGCCCCAGCAACCACTT

CCTTGGGGGGTTTAAGGTTGCAAGTTTCCTCTGGGAGATCTGGCTTTTGTTTTCCAGGTTTGGAGGAGTTTCCCCCCCCCCCTTTTTTTTTCTACATTAC

TCCCCAAGCATATTGAAGCATGTCTTATTCAATGTTATGCAATGGACTTCCACAAAAATTCACTTAGTGTCAGCCACACAATTTTTTTTTAATGCGGTAT

ATTCCCCTGTAAATAGTTTGTGTAAAATTTGACAGAAAAGTCTATTTACTACATTGTAAATACATGTGATGATATATTGTATTATTTTGCTTTTTTGTAA

AGCAGTTAGTTGCTGTACATGGATAACAAACAAAAATTTGATTATTCTTGTGTTCGTATTGTTAACTTCTTCCTGCGACTGCGTTCCATCATTTAAAGAA

AATGCTGTGTATTGTGAACTGACCTTGTATATGATTAACTTACTCCCCTCCCCAACCAGGGGTTCCCTGCCTACAACCTTGTTGATAATGTAACCAGCAG

GAGAACCTCTGCCTGACACACAGACTCCACTGCTGTGGGGAAACATGTTGACGTCTGTCGCAGAGCATCGGCCTCACTTGCTCCTGTCCTGTGTATGCCC

TCCCTCCCACCCACCCCCCCACCCACCCCCTTTTTTTTTTAAAGTAAAATGTAAATTCAATCTGCTCT
Translation
RFPKK - UNI26136 - LPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNM RIFGEAAEKNLYLSQLIILDTLEKCLAG QPK

DTMRLDETMLVKQLLPEICHFLHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTR RLQELTVCSEDNVDVHDIELLQYINVDCAKLKRLLKE 

ETAFKFKALKKVAQLAVINSLEK AFWNWVENYPDEFTKLYQIPQTDMAE ECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISKDVVDES

NINK KLFLDSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLK NLLFNPSKPFSRGSQPADVDLMIDCLVSCFRISPHN

NQHFK ICLAQNSPSTFHYVLVNSLHRIITN SALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAP - UNI26846 - SLTFKEKVTS

LKFKEKPTDLETRSYKCLLLSMVKLIHADPKLLLC - UNI2993 - NPRKQGPETQSSTAELITGLVQLVPQSHMPEVAQEAME - UNI22763 - 

ALLVLHQLDSIDLWNPDAPVETFWEIS - UNI22044 - SSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNK QADRSSCHSLYLYGVG

CEMSATGNTTQMSVDHDEFLRACTPGASLRKGRGNSSM - UNI25725 - DSTAGCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCFRHLCE

EADIRCGVDEVSVHNFLPNYNTFMEFASVSNMMSTG GRAALQKRVMALLRRIEHPTAGNIE AWEDTHAKWEQATKLILNYPKAKMEDGQ - UNI445

9 - AAESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSSSGLATYSPPMGAVSERKGSMISVMSSEGNIDSPVSRFMDRLL

SLMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQ VLLSDSNTQFVEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNLVR 

RYVRVLGNMVHAIQIKTKLCQLVEVMMARRDDLSFCQEMKFR RNKMVEYLTDWVMGTSNQAADDDIKCLTR RDLDQASMEAVVSLLAGLPLQPEEGDG

VELMEAKSQLFLK KYFTLFMNLLNDCSEVEDENAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIG - UNI34152 - GLGYHKDLQT

RATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQW DELARVLVTLFDSRHLLYQLLWNMFSKEVELADSMQTL

FRGNSLASKIMTFCFK VYGATYLQKLLDPLLRVIITSSDWQHVSFEVDPTR RLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPSQLRSVCHCLYQ 

VPKSSCFSCDLNNR RWLASASLRTASVP  - UNI8765 -  - UNI8765 -   - UNI27959 -                      

For any suggestions or comments, please send an email to unitrap@crg.es