Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020721 (Helz)
Chromosomal location
Chr 11: 107409270 - 107555140 (+)
Description
helicase with zinc finger domain Gene [Source:MGI (curated);Acc:Helz-002]
RefSeq_dna
NM_198298 
RefSeq_peptide
NP_938040.1 
UniGene
Mm.272047 Mm.408820 Mm.34220 Mm.383745 Mm.392689 Mm.394603 Mm.408586 Mm.408605 Mm.475224 
MGI
MGI:1925705 
Uniprot/SPTREMBL
Q6DFV5 Q6PAR9 Q8BZZ6 Q8VDI3 A2AAU4 A2AAU3 A2AAU5 Q8CHI3 
Human Ortholog
ENSG00000198265 (HELZ)
Omim not available
UniTrap UNI16845
Vector Insertion
Chr 11: 107409296 - 107410659
Public Clones not available
Private Clones OST453357 (lexicon) OST340891 (lexicon) OST291079 (lexicon) OST282960 (lexicon)
OST248780 (lexicon) OST218932 (lexicon) OST213866 (lexicon) OST198212 (lexicon)
OST198189 (lexicon) OST183705 (lexicon) OST183050 (lexicon) OST181483 (lexicon)
OST179516 (lexicon) OST118782 (lexicon) OST116795 (lexicon) OST115790 (lexicon)
OST94723 (lexicon) OST58311 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8619
Vector Insertion
Chr 11: 107410716 - 107416832
Public Clones XM051 (baygenomics) RRD307 (baygenomics)
Private Clones OST367975 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17082
Vector Insertion
Chr 11: 107416890 - 107436251
Public Clones not available
Private Clones OST449581 (lexicon) OST389682 (lexicon) OST316961 (lexicon) OST307827 (lexicon)
OST284226 (lexicon) OST277371 (lexicon) OST276233 (lexicon) OST219026 (lexicon)
OST217293 (lexicon) OST166762 (lexicon) OST68373 (lexicon) OST63597 (lexicon)
OST59643 (lexicon) OST45436 (lexicon) OST45411 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2638
Vector Insertion
Chr 11: 107436251 - 107436480
Public Clones XP0113 (sanger) XP0545 (sanger) XQ0445 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17208
Vector Insertion
Chr 11: 107436480 - 107439176
Public Clones not available
Private Clones OST447549 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25707
Vector Insertion
Chr 11: 107439214 - 107454019
Public Clones (cmhd)
Private Clones OST169487 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2790
Vector Insertion
Chr 11: 107454145 - 107456452
Public Clones AH0331 (sanger) AH0330 (sanger) AW0090 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5693
Vector Insertion
Chr 11: 107456510 - 107460463
Public Clones CSI645 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI109
Vector Insertion
Chr 11: 107465678 - 107475164
Public Clones GC0539 (tigem) YTC324 (baygenomics) XH658 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38232
Vector Insertion
Chr 11: 107475433 - 107480296
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3629
Vector Insertion
Chr 11: 107481529 - 107487848
Public Clones BC0072 (sanger) RRZ199 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37705
Vector Insertion
Chr 11: 107493665 - 107496293
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1063
Vector Insertion
Chr 11: 107499242 - 107507363
Public Clones AY0014 (sanger) AZ0175 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6796
Vector Insertion
Chr 11: 107507548 - 107510425
Public Clones RHA031 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7069
Vector Insertion
Chr 11: 107510655 - 107517357
Public Clones RRZ080 (baygenomics) XB660 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28056
Vector Insertion
Chr 11: 107517563 - 107522408
Public Clones not available
Private Clones OST41278 (lexicon)
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7618
Vector Insertion
Chr 11: 107527393 - 107531348
Public Clones RRR523 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3079
Vector Insertion
Chr 11: 107531986 - 107532360
Public Clones DC0235 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18935
Vector Insertion
Chr 11: 107534360 - 107546604
Public Clones not available
Private Clones OST410531 (lexicon) OST382153 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6640
Vector Insertion
Chr 11: 107546858 - 107547698
Public Clones RHA258 (baygenomics)
Private Clones OST350166 (lexicon) OST1531 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000075012
Sequence
ATGGCGTAGAAAGTAATGACAG - UNI16845 - GAACTGGATGAAGTAATTGATCACTAATGAACTACAGAGCCGGTGAGATGTGCAAG - UNI26

38 - - UNI8619 - - UNI17082 - GATTTTTGTCCCTGAGTCATGGAAGACAGAAGAGCTGAAAGGTCATGTGAACAAGCGTGCGCGTCACTGC

AGAGGCAGGACTATGACATGGCCCTCCAGCACTGCACCGACGCCCTGCTCTCTCTTGGCCAGTACTCCATGGCAGACTTCACAGGGCCGTGCCCGGTGGA

GGTTGAGCGCATCAAAATTGAGAGTCTTCTTTACAGAATTGCCTCATTCTTGCAATTG - UNI2638 - - UNI17208 - AAAAACTACGGGCAAG

CTGATGAAGATTGTAGGCATG - UNI25707 - TGCTGGGGGAAGGACTGGCCAAGGGAGAGCGTGCCTTCCGGGCAGTGCTGTGCTGCATGCAGCTG

AAAGGGAAGCTCCAGCTTGTGTCCTCCATCCTTGCCAAGTCACTGTCAGGGGAGTCTCTG - UNI2790 - AATGGGATGGTAACGAAAGATTTGACA

AGACTAAAGACACTTCTCACAGAAACAGAG - UNI5693 - ACAGCAACGAGTAATGTCCTGTCTGGATGTCACGTAGAAGACTTAGATGAAG GGTC

CTGTAATGGTTGGCATTTCCGCCCACCGCCCAGGGGCATCACCAGCAGTGAGGAGTACACCTTGTGTAAGAG GTTTTTAGAGCAAGGGATCTGTAGGTA

CGGTGCCCAGTGTACTTCAGCACATTCCCAGGAAGAGCTAGCAGAGTGGCAGAAAAGATACGCCTCCCGACTGATCAAACTGAAGCAGCAAAGTGAGAAT

AAACAGCTCTCAGGCAGCTACATGGAGACCTTGATAGAGAAGTGGATGAGTTCACTGTCTCCTGAGAAAGTG CTTAGTGAATGCATAGAGGGAGTTCAG

GTGGAGCACAGCCCTGACCTGTCGGTCACCGTCAACACCAAAAAATCCCACCAGACGTGGACCTTTGCTCTGACCTGTAAG CCTGCAAGAATGCTGTAT

CGGGTAGCCTTGCTTTATGACGCTCATCGTCCTCATTTCAGTATCATTGCCATATCTGCCGGAGATAGTACTACCCAGGTATCACAAGAAGTCCCCGAGA

ACTGTCAAGAATGGATAGGAGGAAAGATGGCCCAAAATGGATTAGATCATTACGTGTATAAAGTCGGGATAGCATTTAACACAGAAATATTTGGAACTTT

TCGCCAAACCATAGTTTTCGACTTTGGATTGGAGCCAGTACTCATGCAGAGGGTGATGATTGACGCAGCTTCTACAGAAG - UNI109 - ATCTTGAA

TACCTGATGCATGCAAAGCGGCAGCTGGTAACCACAGCCAAGCGCTGGGACTCTTCTTCTAAGACTATTGTAGATTTTGAACCTAATGAAACTACTGATT

TGGAGAAGAGCCTTTTGATCAGATACCAAATTCCTCTGTCTGCTGACCAGCTGTTTACACAGTCCGTCTTAGACAAATCATTGACCAAGACTAACTATCA

GGCACGGCTGCACGACCTGCTTTATATTGAGGAGATAGCCCAGTATAAAGAAGTCAGCAG GTTCAACCTTAAAGTGCAATTGCAGATTTTAGCAAGCTT

CATGCTCACTGGAGTTTCTGGGGGTGCAAAGTATGCTCAGAATGGACAACTTTTTGGTCGTTTCAAGCTTACTGAAACCCTCTCGGAAGACACTTTGGCT

GGACGGCTGGTGATGACCAGGGTCAATGCTGTTTATTTATTACCAGTCCCTAAAGAGAAGCTCGTTCAGTCCCAGGGAACCAAAGAGAAGGTTTATGAAG

CTACTATTGAAGAAAAAACAAAAGACTATGTATTTTTAAGGATATCCAGGGAATGCTGTGAAGAGCTTAGTCTGCGGCCTGACTGTGACATCCAG GTTG

AGCTTCAGTTTCAGTTGAACCGATTACCCCTCTGTGAAATGCATTATGCACTAGACAGGATTAAGGACAATGCTGTTTTGTTTCCAGACATCAGTATGAC

TCCTACCATACCTTGGAGTCCCAACAG - UNI3629 - ACAGTGGGACGAGCAGTTGGATCCTCGGCTAAATGCAAAGCAGAAAGAAGCTGTTCTGGC

CATCACCACTCCACTCTCCATCCAGCTGCCGCCTGTCCTCATCATTGGACCCTACGGGACGGGCAAAACCTTCACTCTGGCTCAGGCGGCCAAGCACATA

CTGCAGCAGCAGGAGACCAG CAGGATTCTCATTTGCACCCATTCTAATAGTGCTGCTGACCTCTACATAAAGGATTATTTACATCCATATGTAGAAGCA

GGCAATCCCCAGGCAAGACCTCTCAG GGTGTATTTCCGGAATCGCTGGGTGAAGACTGTCCACCCAGTCGTGCATCAGTACTGCTTGATCTCGAGCACA

CAGTCCACCTTTCAGATGCCCCAGAAGGAAGATATTCTTAAACATCGAGTGGTGGTGGTCACACTGAGCACTTCCCAGTACCTCTGCCAGCTGGACCTGG

AACCTG GGTTCTTCACGCACGTTCTCTTAGATGAAGCTGCCCAGGCCATGGAGTGTGAGACCATTATGCCTCTAGCCTTAGCTACTAAAAACACACGGA

TTGTTTTGGCTGGTGATCACATGCAG CTCAGCCCTTTTGTTTACAGCGAGTTTGCCAGGGAGAGAAACCTTCACGTTTCGTTACTTGACCGACTCTACG

AGCATTACCCTGCTGAGTTTCCATGCAGGATCCTCCTCTGTGAGAACTATCGTTCCCATGAAGCTATCATCAA CTACACCTCTGAGCTTTTCTATGAGG

GGAAGCTGATGGCCAGTGGGAAGCAGCCGGCGCACAAGGACTTCTATCCACTCACGTTCTTTACGGCACGGGGGGAGGACGTCCAAGAGAAGAACAGCAC

GGCATTCTACAACAATGCAGAG - UNI1063 - GTATTTGAAGTGGTGGAGCGTGTAGAAGAGCTAAGACGGAAGTGGCCAGTGGCATGGGGAAAGTT

AGATGACGGCAGCATCGGTGTGGTGACGCCATACGCTGACCAGGTGTTTAGAATCCGAGCTGAGCTTCGGAAGAAGAGGCTCTCGGATGTGAATGTGGAA

AGGGTGCTCAATGTCCAAG - UNI6796 - GAAAGCAGTTCAGAGTTCTGTTTCTTAGCACAGTGCGTACACGCCACACTTGCAAGCACAAGCAGACG

CCAATTAAAAAGAAAGAGCAACTCCTGGAAGACTCCACCGAGGACTTAGATTATGGTTTTCTATCCAACTACAAACTTCTCAATACGGCCATCACCAGAG

CACAGTCCTTGGTTGCTGTGGTGGGTGACCCTGTTGCTCTGTGCTCTATTGGAAGGTGTAG - UNI7069 - AAAGTTTTGGGAGCGGTTTATTGCCC

TGTGTCATGAAAACCACAGCTTGCACGGGATCACGTTCGAACAGATCAAGGCACAGTTAGAGGCTTTAGAACTCAAGAAGACTTACGTGTTGAATCCACT

GGCTCCTGAGTTTATCCCCCGGGCTTTACGACTGCAGCATTCAGGAAACAGTAGCAGACAGCAGCAGTCACCACCCAAG - UNI28056 - GTGAAAA

GCCTCTATCATCCCCAGAGTGATCATTTCCAGAGTGATGGAATTG TTCAGCCCAATCCTTCCGTACTTATTGGCAATCCTATTAGAGCATATACTCCTC

CGCCCCCTCTTGGACCGCACCCAAACTTGGGAAAATCTCCAAGCCCCGTTCAAAGAATAGATCCTCACACTGGGACTAGTATTCTTTACGTACCTGCTGT

CTATGGAGGAAATGTAGTTATGTCGGTGCCTTTACCT GTGCCATGGACAGGGTACCAGGGTAGGTTTGCAGTTGACCCTCGGATTATCACACACCAGGC

AGCAATGGCCTACAATATGAACCTATTACACACACACGGACGTGGGTCACCGATCCCTTATGGTCTTGGCCATCACCCACCTGTCAGCCTAGGCCAGCCA

CAGAGTCAGCACGCAGAGAAGGATCAGCAGGAGCAAAACCGAAATG GTAAAACTGATACAAATAACCCTGGACCTGAAATTAATAAGATCCGAACACCA

GAGAAGAAACCTACAGAGCCCAAGCAG - UNI7618 - GTTGATTTGGAATCAAATCCACAGAACAGAAGTCCTGAATCCCGTCCTGGTGTTGTTTAT

TCCAACACTAAATTTCCTCGAAAAGATCATCTCAACCCAAGACACATAAATAATCTCCCTCTTCCTGCACCACACGCCCAGTATGCAATCCCTAGCCGCC

ATTTTCACCCGCTGCCTCAGCTGCCCAGGCCGCCGTTTCCCGCTTCCCAGCCGCACACCTTGTTAAATCAGCAACAGAATAATTTGCCTGAACAACCAAA

TCAGATGGCACCTCAGCCAAATCAGGTGGCACCCCAGCCAAATCAGATGACACCCCAGCCAAATCAGGTGGCACCCCAGCCAAATCAGGTGGTCCAGCAG

CAGAGCCAGGCACCTCCACAGGCCCCACAGCCAGCACCTCAACTCTCTCCTGCATTTCAGGCGGGGCCCACCAATGCATTTTTCAATAATGCAGTTGCTC

ACCGACCACAGTCTCCTGCTGCAGAGGCTGTGGGTCCTGAGCAGCCGCCCCCTCCCGGGCTGCCCGATGGCCACAGTCCACTGAGAGCCATCACACAGCC

TGGCCCCATCCTGGCATCACCTTTGAACAACTTTGTTGATGAGAGCTCTCCAGGATTGCCTATAGAAGAAGCTTTGG - UNI3079 - ATGGAGTGCA

TGGAAGCGTAGCTCTGGAGACGCTGAGGCAGCAGCAGGCGCGGCTACAGCAGTGGAGTGAGCACCATGCCTACCTGAGCCAGGGCGGCATCCCCTATTCA

CACCATCACCATCCTCACCTCCCGCATCTTCCCCACACACCCATTGGCCTCCACCAGCCACCAGTGAGGGCAGAGTGGAAAGTCGCCGGCAGGGCTGACG

ATGAAACAGAGACAACATTCTCAAG GTTTCAAGACTTACTCAGAGAGCTGTCCCATCGGGATCAAGGTGACACTGGAGAACTAGCTGAAATGCCACCAC

CTCAGTCAAGACTTCTGCAGTACAGACAAGTTCAGCCTAGAAGTCCGCCAGCGGTCCCGTCTCCCCCTTCCTCCACAGACCACAGTAGCCAGTTTGCTAA

CTTTAATGACAGCAGCAGAGACATTGAAGTAGCCAACAGCCCAGCATTCCCGCAGCGCCTCCCGCCTCAGCTATTTGGCTCCCCTTTCTCGTTGCCATCT

GAACACCTTGCCCCTCCTCCTCTGAAATACCTGGCTCCGGAAGGAGCATGGAATTTTGCTAACTTGCAGCAGAATCACTTAATAGGGCCGGGCTTTCCCT

ATGGCCTACCTCCATTGCCTCCCAGGCCACCACAGAACCCTTTTATACACATCCAGAACCATCAACACGCTGCTGGTCAAGAGCCATTTCACCCACTGTC

ATCTCGAACAGTGTCTGCTTCTTCGCTCCCCAGCCTAGAAGAG - UNI18935 - TATGAGCCCAGAGGACCTGGTCGGCCCTTGTACCAAAGAAGAA

TCTCATCTAGCTCAGCCCAGCCTTGTGTGGAAGAGGCAAGCGCTCCCCAAGACAGCCTGGCTCAGGGCAAAGAATCGCAGGGCCACAGCAACCCACCTGC

CTTCAACTTCCCGGCCCCCGAGTCCTGGGCCAACACCACCTCATCTGCCCCCTACCAGAACATTCCGTGCAATGGATCCAGCAGGACGAGTCAGCCCAGA

GAGTTGATAG - UNI6640 - CTCCACCCAAGACTGTCAAACCCCCTGAGGATCAGCTGAAGCCCGAGAGCGGGGAGGTGTCCAGTTCCTTCAACTAC

TCGATGCTGCAGCACCTTGGCCAGTTCCCACCCCTCATGCCCAACAAGCAGATCGCAGAGTCCGCCAACTGCAGCAGCCAGCAGAGCCCGGCAGGGAGCA

AGCCCGCCATGTCCTACGCCAGTGCGCTGCGGGCCCCGCCCAAGCCCAGGCCGCCACCCGAGCAGGCCAAGAAGGGCAGCGACCCGCTGTCCCTGCTCCA

GGAGCTCAGTCTGGGCAGCAGCCCGGGCAGCAATGGCTTCTACTCCTACTTCAAGTGACCCCGCTCGCGCTGTCCTCAGAGAATATGCGGTTCCTGTCCA

GTCTGCAGGATGGAGGTGGCGGCTCTGTGTGCGTGCAGCCCTCCATTACGTTCACTGCGCTCTCAGCCCCCTTGCTGCTAGACCTGCGCCTACGTTTAAA

AGTATATTCCATTATTTTGCATTTTTGATGTGAGTCAGAATTTTGACAGCTTTTATGTAGAATAAAAATATTTTTAAATTTG
Translation
 - UNI16845 -  - UNI2638 - - UNI8619 - - UNI17082 - MEDRRAERSCEQACASLQRQDYDMALQHCTDALLSLGQYSMADFTGPC

PVEVERIKIESLLYRIASFLQL - UNI2638 - - UNI17208 - KNYGQADEDCRHV - UNI25707 - VLGEGLAKGERAFRAVLCCMQLKGK

LQLVSSILAKSLSGESL - UNI2790 - NGMVTKDLTRLKTLLTETE - UNI5693 - TATSNVLSGCHVEDLDEG GSCNGWHFRPPPRGITSSE

EYTLCKR RFLEQGICRYGAQCTSAHSQEELAEWQKRYASRLIKLKQQSENKQLSGSYMETLIEKWMSSLSPEKV LSECIEGVQVEHSPDLSVTVNTKK

SHQTWTFALTCK PARMLYRVALLYDAHRPHFSIIAISAGDSTTQVSQEVPENCQEWIGGKMAQNGLDHYVYKVGIAFNTEIFGTFRQTIVFDFGLEPVL

MQRVMIDAASTED - UNI109 - DLEYLMHAKRQLVTTAKRWDSSSKTIVDFEPNETTDLEKSLLIRYQIPLSADQLFTQSVLDKSLTKTNYQARLHD

LLYIEEIAQYKEVSR RFNLKVQLQILASFMLTGVSGGAKYAQNGQLFGRFKLTETLSEDTLAGRLVMTRVNAVYLLPVPKEKLVQSQGTKEKVYEATIE

EKTKDYVFLRISRECCEELSLRPDCDIQ VELQFQLNRLPLCEMHYALDRIKDNAVLFPDISMTPTIPWSPNR - UNI3629 - RQWDEQLDPRLNAK

QKEAVLAITTPLSIQLPPVLIIGPYGTGKTFTLAQAAKHILQQQETS SRILICTHSNSAADLYIKDYLHPYVEAGNPQARPLR RVYFRNRWVKTVHPV

VHQYCLISSTQSTFQMPQKEDILKHRVVVVTLSTSQYLCQLDLEPG GFFTHVLLDEAAQAMECETIMPLALATKNTRIVLAGDHMQ LSPFVYSEFARE

RNLHVSLLDRLYEHYPAEFPCRILLCENYRSHEAIIN NYTSELFYEGKLMASGKQPAHKDFYPLTFFTARGEDVQEKNSTAFYNNAE - UNI1063 -

 VFEVVERVEELRRKWPVAWGKLDDGSIGVVTPYADQVFRIRAELRKKRLSDVNVERVLNVQG - UNI6796 - GKQFRVLFLSTVRTRHTCKHKQTP

IKKKEQLLEDSTEDLDYGFLSNYKLLNTAITRAQSLVAVVGDPVALCSIGRCR - UNI7069 - RKFWERFIALCHENHSLHGITFEQIKAQLEALEL

KKTYVLNPLAPEFIPRALRLQHSGNSSRQQQSPPK - UNI28056 - VKSLYHPQSDHFQSDGIV VQPNPSVLIGNPIRAYTPPPPLGPHPNLGKSP

SPVQRIDPHTGTSILYVPAVYGGNVVMSVPLP VPWTGYQGRFAVDPRIITHQAAMAYNMNLLHTHGRGSPIPYGLGHHPPVSLGQPQSQHAEKDQQEQN

RNG GKTDTNNPGPEINKIRTPEKKPTEPKQ - UNI7618 - VDLESNPQNRSPESRPGVVYSNTKFPRKDHLNPRHINNLPLPAPHAQYAIPSRHFH

PLPQLPRPPFPASQPHTLLNQQQNNLPEQPNQMAPQPNQVAPQPNQMTPQPNQVAPQPNQVVQQQSQAPPQAPQPAPQLSPAFQAGPTNAFFNNAVAHRP

QSPAAEAVGPEQPPPPGLPDGHSPLRAITQPGPILASPLNNFVDESSPGLPIEEALD - UNI3079 - DGVHGSVALETLRQQQARLQQWSEHHAYLS

QGGIPYSHHHHPHLPHLPHTPIGLHQPPVRAEWKVAGRADDETETTFSR RFQDLLRELSHRDQGDTGELAEMPPPQSRLLQYRQVQPRSPPAVPSPPSS

TDHSSQFANFNDSSRDIEVANSPAFPQRLPPQLFGSPFSLPSEHLAPPPLKYLAPEGAWNFANLQQNHLIGPGFPYGLPPLPPRPPQNPFIHIQNHQHAA

GQEPFHPLSSRTVSASSLPSLEE - UNI18935 - YEPRGPGRPLYQRRISSSSAQPCVEEASAPQDSLAQGKESQGHSNPPAFNFPAPESWANTTSS

APYQNIPCNGSSRTSQPRELIA - UNI6640 - APPKTVKPPEDQLKPESGEVSSSFNYSMLQHLGQFPPLMPNKQIAESANCSSQQSPAGSKPAMSY

ASALRAPPKPRPPPEQAKKGSDPLSLLQELSLGSSPGSNGFYSYFK
Transcript ENSMUST00000106746
Sequence
GAAAGTAATGACAG - UNI16845 - GAACTGGATGAAGTAATTGATCACTAATGAACTACAGAGCCGGTGAGATGTGCAAG - UNI8619 - AAA

TTATAAAGAGCTCTGATGGGCTATTTGGGTGTTACCCAGTGCAGTGAACTGCAG - UNI2638 - - UNI17082 - GATTTTTGTCCCTGAGTCAT

GGAAGACAGAAGAGCTGAAAGGTCATGTGAACAAGCGTGCGCGTCACTGCAGAGGCAGGACTATGACATGGCCCTCCAGCACTGCACCGACGCCCTGCTC

TCTCTTGGCCAGTACTCCATGGCAGACTTCACAGGGCCGTGCCCGGTGGAGGTTGAGCGCATCAAAATTGAGAGTCTTCTTTACAGAATTGCCTCATTCT

TGCAATTG - UNI2638 - - UNI17208 - AAAAACTACGGGCAAGCTGATGAAGATTGTAGGCATG - UNI25707 - TGCTGGGGGAAGGAC

TGGCCAAGGGAGAGCGTGCCTTCCGGGCAGTGCTGTGCTGCATGCAGCTGAAAGGGAAGCTCCAGCTTGTGTCCTCCATCCTTGCCAAGTCACTGTCAGG

GGAGTCTCTG - UNI2790 - AATGGGATGGTAACGAAAGATTTGACAAGACTAAAGACACTTCTCACAGAAACAGAG - UNI5693 - ACAGCAA

CGAGTAATGTCCTGTCTGGATGTCACGTAGAAGACTTAGATGAAG GGTCCTGTAATGGTTGGCATTTCCGCCCACCGCCCAGGGGCATCACCAGCAGTG

AGGAGTACACCTTGTGTAAGAG GTTTTTAGAGCAAGGGATCTGTAGGTACGGTGCCCAGTGTACTTCAGCACATTCCCAGGAAGAGCTAGCAGAGTGGC

AGAAAAGATACGCCTCCCGACTGATCAAACTGAAGCAGCAAAGTGAGAATAAACAGCTCTCAGGCAGCTACATGGAGACCTTGATAGAGAAGTGGATGAG

TTCACTGTCTCCTGAGAAAGTG CTTAGTGAATGCATAGAGGGAGTTCAGGTGGAGCACAGCCCTGACCTGTCGGTCACCGTCAACACCAAAAAATCCCA

CCAGACGTGGACCTTTGCTCTGACCTGTAAG CCTGCAAGAATGCTGTATCGGGTAGCCTTGCTTTATGACGCTCATCGTCCTCATTTCAGTATCATTGC

CATATCTGCCGGAGATAGTACTACCCAGGTATCACAAGAAGTCCCCGAGAACTGTCAAGAATGGATAGGAGGAAAGATGGCCCAAAATGGATTAGATCAT

TACGTGTATAAAGTCGGGATAGCATTTAACACAGAAATATTTGGAACTTTTCGCCAAACCATAGTTTTCGACTTTGGATTGGAGCCAGTACTCATGCAGA

GGGTGATGATTGACGCAGCTTCTACAGAAG - UNI109 - ATCTTGAATACCTGATGCATGCAAAGCGGCAGCTGGTAACCACAGCCAAGCGCTGGGA

CTCTTCTTCTAAGACTATTGTAGATTTTGAACCTAATGAAACTACTGATTTGGAGAAGAGCCTTTTGATCAGATACCAAATTCCTCTGTCTGCTGACCAG

CTGTTTACACAGTCCGTCTTAGACAAATCATTGACCAAGACTAACTATCAGGCACGGCTGCACGACCTGCTTTATATTGAGGAGATAGCCCAGTATAAAG

AAGTCAGCAG GTTCAACCTTAAAGTGCAATTGCAGATTTTAGCAAGCTTCATGCTCACTGGAGTTTCTGGGGGTGCAAAGTATGCTCAGAATGGACAAC

TTTTTGGTCGTTTCAAGCTTACTGAAACCCTCTCGGAAGACACTTTGGCTGGACGGCTGGTGATGACCAGGGTCAATGCTGTTTATTTATTACCAGTCCC

TAAAGAGAAGCTCGTTCAGTCCCAGGGAACCAAAGAGAAGGTTTATGAAGCTACTATTGAAGAAAAAACAAAAGACTATGTATTTTTAAGGATATCCAGG

GAATGCTGTGAAGAGCTTAGTCTGCGGCCTGACTGTGACATCCAG GTTGAGCTTCAGTTTCAGTTGAACCGATTACCCCTCTGTGAAATGCATTATGCA

CTAGACAGGATTAAGGACAATGCTGTTTTGTTTCCAGACATCAGTATGACTCCTACCATACCTTGGAGTCCCAACAG - UNI3629 - ACAGTGGGAC

GAGCAGTTGGATCCTCGGCTAAATGCAAAGCAGAAAGAAGCTGTTCTGGCCATCACCACTCCACTCTCCATCCAGCTGCCGCCTGTCCTCATCATTGGAC

CCTACGGGACGGGCAAAACCTTCACTCTGGCTCAGGCGGCCAAGCACATACTGCAGCAGCAGGAGACCAG GATTCTCATTTGCACCCATTCTAATAGTG

CTGCTGACCTCTACATAAAGGATTATTTACATCCATATGTAGAAGCAGGCAATCCCCAGGCAAGACCTCTCAG GGTGTATTTCCGGAATCGCTGGGTGA

AGACTGTCCACCCAGTCGTGCATCAGTACTGCTTGATCTCGAGCACACAGTCCACCTTTCAGATGCCCCAGAAGGAAGATATTCTTAAACATCGAGTGGT

GGTGGTCACACTGAGCACTTCCCAGTACCTCTGCCAGCTGGACCTGGAACCTG GGTTCTTCACGCACGTTCTCTTAGATGAAGCTGCCCAGGCCATGGA

GTGTGAGACCATTATGCCTCTAGCCTTAGCTACTAAAAACACACGGATTGTTTTGGCTGGTGATCACATGCAG CTCAGCCCTTTTGTTTACAGCGAGTT

TGCCAGGGAGAGAAACCTTCACGTTTCGTTACTTGACCGACTCTACGAGCATTACCCTGCTGAGTTTCCATGCAGGATCCTCCTCTGTGAGAACTATCGT

TCCCATGAAGCTATCATCAA CTACACCTCTGAGCTTTTCTATGAGGGGAAGCTGATGGCCAGTGGGAAGCAGCCGGCGCACAAGGACTTCTATCCACTC

ACGTTCTTTACGGCACGGGGGGAGGACGTCCAAGAGAAGAACAGCACGGCATTCTACAACAATGCAGAG - UNI1063 - GTATTTGAAGTGGTGGAG

CGTGTAGAAGAGCTAAGACGGAAGTGGCCAGTGGCATGGGGAAAGTTAGATGACGGCAGCATCGGTGTGGTGACGCCATACGCTGACCAGGTGTTTAGAA

TCCGAGCTGAGCTTCGGAAGAAGAGGCTCTCGGATGTGAATGTGGAAAGGGTGCTCAATGTCCAAG - UNI6796 - GAAAGCAGTTCAGAGTTCTGT

TTCTTAGCACAGTGCGTACACGCCACACTTGCAAGCACAAGCAGACGCCAATTAAAAAGAAAGAGCAACTCCTGGAAGACTCCACCGAGGACTTAGATTA

TGGTTTTCTATCCAACTACAAACTTCTCAATACGGCCATCACCAGAGCACAGTCCTTGGTTGCTGTGGTGGGTGACCCTGTTGCTCTGTGCTCTATTGGA

AGGTGTAG - UNI7069 - AAAGTTTTGGGAGCGGTTTATTGCCCTGTGTCATGAAAACCACAGCTTGCACGGGATCACGTTCGAACAGATCAAGGCA

CAGTTAGAGGCTTTAGAACTCAAGAAGACTTACGTGTTGAATCCACTGGCTCCTGAGTTTATCCCCCGGGCTTTACGACTGCAGCATTCAGGAAACAGTA

GCAGACAGCAGCAGTCACCACCCAAG - UNI28056 - GTGAAAAGCCTCTATCATCCCCAGAGTGATCATTTCCAGAGTGATGGAATTG TTCAGCC

CAATCCTTCCGTACTTATTGGCAATCCTATTAGAGCATATACTCCTCCGCCCCCTCTTGGACCGCACCCAAACTTGGGAAAATCTCCAAGCCCCGTTCAA

AGAATAGATCCTCACACTGGGACTAGTATTCTTTACGTACCTGCTGTCTATGGAGGAAATGTAGTTATGTCGGTGCCTTTACCT GTGCCATGGACAGGG

TACCAGGGTAGGTTTGCAGTTGACCCTCGGATTATCACACACCAGGCAGCAATGGCCTACAATATGAACCTATTACACACACACGGACGTGGGTCACCGA

TCCCTTATGGTCTTGGCCATCACCCACCTGTCAGCCTAGGCCAGCCACAGAGTCAGCACGCAGAGAAGGATCAGCAGGAGCAAAACCGAAATG GTAAAA

CTGATACAAATAACCCTGGACCTGAAATTAATAAGATCCGAACACCAGAGAAGAAACCTACAGAGCCCAAGCAG - UNI7618 - GTTGATTTGGAAT

CAAATCCACAGAACAGAAGTCCTGAATCCCGTCCTGGTGTTGTTTATTCCAACACTAAATTTCCTCGAAAAGATCATCTCAACCCAAGACACATAAATAA

TCTCCCTCTTCCTGCACCACACGCCCAGTATGCAATCCCTAGCCGCCATTTTCACCCGCTGCCTCAGCTGCCCAGGCCGCCGTTTCCCGCTTCCCAGCCG

CACACCTTGTTAAATCAGCAACAGAATAATTTGCCTGAACAACCAAATCAGATGGCACCTCAGCCAAATCAGGTGGCACCCCAGCCAAATCAGATGACAC

CCCAGCCAAATCAGGTGGCACCCCAGCCAAATCAGGTGGTCCAGCAGCAGAGCCAGGCACCTCCACAGGCCCCACAGCCAGCACCTCAACTCTCTCCTGC

ATTTCAGGCGGGGCCCACCAATGCATTTTTCAATAATGCAGTTGCTCACCGACCACAGTCTCCTGCTGCAGAGGCTGTGGGTCCTGAGCAGCCGCCCCCT

CCCGGGCTGCCCGATGGCCACAGTCCACTGAGAGCCATCACACAGCCTGGCCCCATCCTGGCATCACCTTTGAACAACTTTGTTGATGAGAGCTCTCCAG

GATTGCCTATAGAAGAAGCTTTGG - UNI3079 - ATGGAGTGCATGGAAGCGTAGCTCTGGAGACGCTGAGGCAGCAGCAGGCGCGGCTACAGCAGT

GGAGTGAGCACCATGCCTACCTGAGCCAGGGCGGCATCCCCTATTCACACCATCACCATCCTCACCTCCCGCATCTTCCCCACACACCCATTGGCCTCCA

CCAGCCACCAGTGAGGGCAGAGTGGAAAGTCGCCGGCAGGGCTGACGATGAAACAGAGACAACATTCTCAAG GTTTCAAGACTTACTCAGAGAGCTGTC

CCATCGGGATCAAGGTGACACTGGAGAACTAGCTGAAATGCCACCACCTCAGTCAAGACTTCTGCAGTACAGACAAGTTCAGCCTAGAAGTCCGCCAGCG

GTCCCGTCTCCCCCTTCCTCCACAGACCACAGTAGCCAGTTTGCTAACTTTAATGACAGCAGCAGAGACATTGAAGTAGCCAACAGCCCAGCATTCCCGC

AGCGCCTCCCGCCTCAGCTATTTGGCTCCCCTTTCTCGTTGCCATCTGAACACCTTGCCCCTCCTCCTCTGAAATACCTGGCTCCGGAAGGAGCATGGAA

TTTTGCTAACTTGCAGCAGAATCACTTAATAGGGCCGGGCTTTCCCTATGGCCTACCTCCATTGCCTCCCAGGCCACCACAGAACCCTTTTATACACATC

CAGAACCATCAACACGCTGCTGGTCAAGAGCCATTTCACCCACTGTCATCTCGAACAGTGTCTGCTTCTTCGCTCCCCAGCCTAGAAGAG - UNI1893

5 - TATGAGCCCAGAGGACCTGGTCGGCCCTTGTACCAAAGAAGAATCTCATCTAGCTCAGCCCAGCCTTGTGTGGAAGAGGCAAGCGCTCCCCAAGAC

AGCCTGGCTCAGGGCAAAGAATCGCAGGGCCACAGCAACCCACCTGCCTTCAACTTCCCGGCCCCCGAGTCCTGGGCCAACACCACCTCATCTGCCCCCT

ACCAGAACATTCCGTGCAATGGATCCAGCAGGACGAGTCAGCCCAGAGAGTTGATAG - UNI6640 - CTCCACCCAAGACTGTCAAACCCCCTGAGG

ATCAGCTGAAGCCCGAGAGCGGGGAGGTGTCCAGTTCCTTCAACTACTCGATGCTGCAGCACCTTGGCCAGTTCCCACCCCTCATGCCCAACAAGCAGAT

CGCAGAGTCCGCCAACTGCAGCAGCCAGCAGAGCCCGGCAGGGAGCAAGCCCGCCATGTCCTACGCCAGTGCGCTGCGGGCCCCGCCCAAGCCCAGGCCG

CCACCCGAGCAGGCCAAGAAGGGCAGCGACCCGCTGTCCCTGCTCCAGGAGCTCAGTCTGGGCAGCAGCCCGGGCAGCAATGGCTTCTACTCCTACTTCA

AGTGACCCCGCTCGCGCTGTCCTCAGAGAATATGCGGTTCCTGTCCAGTCTGCAGGATGGAGGTGGCGGCTCTGTGTGCGTGCAGCCCTCCATTACGTTC

ACTGCGCTCTCAGCCCCCTTGCTGCTAGACCTGCGCCTACGTTTAAAAGTATATTCCATTATTTTGCATTTTTGATGTGAGTCAGAATTTTGACAGCTTT

TATGTAGAATAAAAATATTTTTAAATTTGTGTATTGTTACATATGTTTGCATCAAGCTAGCAGCTAAGAGGTTAACTGTGCAACTATAAAAAAAAGAAAA

AAAAGTTTGTCTAAAATGTATTTAAAAAGAAAAAAATTGTTAAGTAGCATTTACATTTATTCAATAATATTACCACATGCTGGGTTTCTGTACCAGAAAT

GGCCAGTTGATGTACAAATGTATGTTATTTTTGCTTAAATTCAGTTAAAAATTTAAAAAAAAAAACAAAGGGGCAGCATCTTCTAAGACCCCCTCCCCCC

TTTTTTGTGATCACAGGATGCTGCGTTCTAAAACTTTCCGAGTTTTAGACGATCTGTGACGTGCTCTTCTCTCCATCAGCATAGGGGAGGCCAAGGCTGC

CTTTGCCCGAGTATTCTGCATGCCACCACTGGGTTTTGAAATGTGAAAAAGAAAAAAGGAAAAAAAAAAAAAAAGCAACCCTGGTGGCATAGTCAGTTTT

CTTTGTTTTGTTTTTGACAAGCAAGACTTCCAGCTTGTCTTTAACATTGAGGTGAGAGGGTTTGGTTTGGTTTAAACAAATGGGGAAGCTGAAGCATTTT

TAGGATTGTTGGTGCTTAGTAGACTTGATAACTATTTTAAAACTGCGTGAATTTAGTGAAAAATATTTTTTCTCACTCTGCATGTGTAAGTGTTCGTAGC

CTGGCCCCCTCCTCCAGGGCAGAAAGACCTGTGCCAACTAACGGTTTGGGTTGCTTTTCCTCCATTAACAATGTTGGTACCTTATTGATGTTTACGTTAA

GATGATGTGACCTACACAGAGCAATTCTAAGATCTTTCTAAGATGTTACATACACAGAGCAATTCTAAGATCTTTCTAATTGCTTGTTTGAGGGATATCA

TTAAAGGAAAAAAAAAACATTGTCAAAAATTGATGAAAATCTAGGGTATGTTTCAGATCCTTTGAATCATCTGAAATTCCCCCCTTGAACTCATTAGAAA

TATGAAATTTAAGCAACTGTCCGCAGAGATCCACAGCCTGCCAGTTGTTTTGAATGAACGTTGAAGGAAGAGGTTGTCCTCACGTGTTAACACATCCGAA

ACAATGAATGTCCTTTGTCATTTCCTGATCCCGTAGCTCTAATTTTGTATTTCTGAGAAATCTTGAGACTACAATCTATCTTTTTTTTTTTTTTTTCCTT

TTTAAACTAAGATGAGGCCAGGGGGATATTTCAAAAGAGGCCGACTTTCCTGCCGATCACACATACTTTTCTGGAAGACTTTTGATAGACCATTTTAAGA

TGGGTTGGATGTGGCAAGGGGGCAGCAGAATTAGTCTGTGTGACTAGAGGTTAGTCTATTGCAGCCAGCCACAGCCCCCTGTGTGGGCTACACAGGCTGC

GATTAAAGGCTACGTTGGTTAAGGGGCAGCAAACTCCTGCACTGATGATACAGCCTCTCAGATTCAGTTCTGCCTCTGTGCTCAGGACTGGGCTACTGGA

ACCTGGCTTCCTGTTGTTCCTGTCTCGGGCTACATGCCTCTTCTGAGCTGCCAGGTATGGACGGACCCACAGACTAAAGTGGTGTTCACAGATCCCGGCA

GGCACGGGGATCCACTGAGTCAGGACACCACATTCTGCGTGACATGACATCATCACATGCTGGCGTGACGCAGGCAGAATGAGACAACTTTTGCCACAGG

TCTCTGTTTGCTAACTCTGTGCCCAAGTAGGACTCACCCATGATAGAGCTGTCTGTGTCCCATAGGTGAGTGCCCCCACGCCCACGCATGCAGACACACA

GGACAAAGTACATGCCGGGCAAGAGTTCAGAGCCATCCTGCTAATTCAGACAGAGTTATACTGTCAGTTTTCGGGTCACCTCTCGCCAGGAGATCATTGC

CTACTTTTTTGTTTTTCATACTTGAACCTTTAAAAATATATGAGTTTTTTAAATTATTTATATTTAGTTAAAGTCACGTGTGCACCCTATCATCTTATAT

AAGACACTGATGGTGGGACCCCGGGGATGGGGAACCCGTCAGGTTGCGGTGACATTCTCAACGTGGTTATGTCTAAGAAATGACACTAGCTACTTCCTTA

CTTGACTGCGCTGTTGCGAGTGTCGGTGCGTTCCCATCTCTCTCCTGCTTCTGCAGTTGGGGGTTTCCTTCCGTCGCTTCACGGTCTGGTTAGAGTACTT

ATCCCTCCTTCCCAGCGTTACTCTTGTCTTCCCGTCCAGGCTCTAAAAAGCCTATTTCTTACACCCAGCACCTCGTAACAGTCGACAGCAGACCTTACCA

GAAGAGCCATTGCGAGCTCTCGCTTGGGGCTCTCTGCAGTCACCCCGGTAGCATTAGCAGGGTTAGTCAGCCTCCCGGAAATAGCTTGCTTCTTTCATTC

AACTTTAGAGTTCAGATGGGACATGTGTACATACGTGTGTATATACGTGTTTGTTTACATACATAAGCACACATTTATTATTTTTTTAAGGAAAACTTGA

TAGGTCTGCCATGCCTTTTCTTCTCCTGAGTTTCCTTTATGGTTTCTTCTCTTCTCTTCATCCTTTCCCGTCGGAGGCGTTTCCTTGTCCTTGCCAGTAC

TGGTTTTAGCCATTGCAGTACAAACTCGAGGTGTTTCTTTCTTCCCTTTCTGTCCCTCTCTCCTTCATCTTTCTCTTCCAGTTCTTTTAGGTGATAATTC

AGAGTATTCGCGCTAAGTTTGTTCCCCTCCCCCACCCCCCCACCCTTTATCTCTTGATCTAAAAATAAATTCCTGATGAGAATTGACAAGCCTCATTCAC

TGTATCATGGGTATTTTCTGGTGTGTTTTTTTCAAAGAAGTCCATTGTGGCCCCACGCTTGCTAGTCACGTTATCTCGTCCTTGACCAGTCAGTCGTTAG

TTATTGATCATGGAGACTAAGGATCTCGGTCTTCCTGTCGTCACACAGACATGCTCGCTGTCTGGGTCATCTTGTGTGAGGAGAACAAAATTGTCTGCTG

TGGGTTCTTTTTCTTTTGCCTTGTTTCTAATCAAGATCGTAGGATGAGTTCAGGTTTGATGTAAGCATCAACTGGTCCTTTCTGTTCAGAGAACTTCAGG

GTAAGGAAAATACGCGGAAGTCTCCCAGAGTAAGCATTCCCCAGTAAACATGGCGGTCTCTGGAGCCTATGCATTGGAGAGGTTTTCCTCTTTCTGAAGG

CCTTGAGGTTCTGAGGAAACTGTCTTTTTAATCTTGAGCTCATATGCTGTGTTATGTTGCTGTAGTGTAGTTAATGGTTCTAAGTTTGGTATGTTTCATT

TTGAGAGCAAAGCTGAAAACATAAAAGAATGTATCTCTCTAGCCACCGCGACTGCGAGTCAGGGTGTGGAGAACAATTTTAGGCTAAATCTGAACATTCC

CACGATTGTCATGGGAAATGTTAGATTTCCTGAACTAGGTGATTTTTTGTTTGTTTGTTTGTTTTTTTAAGGAGATGCTCATGAGCGAAAGAATCATTGC

GTAGTGGAGAGTTTTATTAGTAGAAAAATTATGTAGAAACATAAGTTTAAAACTTCCCATAGAGTAAAACATACACATTACTGCTTTAAAATATTACCTA

GGCTGTCCATCCCTCCCCCACCCACCTCTCCACCTCCTCACACTTAAACCCGCCTTTTCTCAGTGAGTAGATCCGGGTTTGTTTGTTTGTTTGTTATTCT

TGCCTTTCCCATAATGTTTGACAACCCTGCTCCCAACCGCCCCATGTGTCCTGCTCACATCTGGGCGCAGGTGTCATCTGATCAGTATTCACACTGCCCA

GAAGTTAGAGAAGAGGCAGGTGGTGCTTGCTCTCCTTGTTCAGAGCATCACTTGGTGTGTCCCTGGTAGCCTGGTACCCAGAGTACCCGTCATACGGGTC

CTCAGAGCATCCACTCCATCAAGCCTTCACATTTCCCTCTGCGACTTGACAGAGGCTTCGAGGTTCACACTTGCCAGTTTTATCCCTCGTTTAACTAGCA

ATTCCAAGACCACAGAAGGAGGGGATTTTTACTGAAGTTTAGCATCCCAATAAAACATCAGAAAGTGGCATTATATCATCAACTCTAAGCTAGAATATCA

GGTCAAACAATTTTTATGTTTAAAGTTTTAGTGTAACATTCAGATATTTCGAACCTACTGAAAATATCTACTTAACAAAACCTGCATTGTTTAAAAAAGA

AAAAAAGAAAAAGAAAAAAACTTTATGTCAGGAGGTACATAATAGAAGACTCTAGACTTAGACTTGTGAGCTGTGGTTCTAATCCAGCCCATTTGTCCAG

TGGTAAGCTTGAAGCTTCTGAAATGAGTTTCAAGAGAGCCTACAAGTCTTATAGTTTCAGTCATCAGAGTGGTAGACCAGACTTTACTTGCAATTTGTTC

AACAGAGAGATTTTATTTTGATACAAATATTAAACATAATGCATAGTAAGTTTTATATAATTCTATGAGTTCATTAAACAATATTATGAGATTTTCAGTA

TTTTGGGGGGGGCGTCTTTTTGGCTATTTCTACCTCATATGAGGTCTCTTCTGTATTTTATTTAGTATACTAGCATGTGCTTGCCTGCCTTAGAATGATG

TACGGGAGGGGAAATCAATATTACCTTTTAAGAAAAATTTTGATTTTTATGGAATAATTGTTTTAATATTTTAATGTTTGAAACTGAGGGGGGTAAGGGT

GGCAGATAACATACAGTGGTAACTATTTACAAACCTATCATATTTTAAGATTTTAGAATTGTGAGCAAGATCAAGAAAAATAAAGGGGGAAAAAAAAGTG

ATTATGAAGCTGAAGCTGGCCTCAGTTTTCCCTGGACGGGTTGTTGAGATTGCTGGGCCCACTGCCAGGGTGGCGTCACAGCCGTCCAGGAAGCGCACTT

TGAGAGTCAGGAGGGGTTTATCTCTTTACTCGTGGGCCATTTTAATCATCCTGGCACCTCAAGTGGCCCGTTCGTGGGAAGAGCTCTCTCTCCCTTTGGG

GTCTCTGCTACTCCTCATTAGGGTGCAGGGGCGCTTTCATTTCTGGAGTGAGTTTGTTGTTAGTGACGCAGCTGCCTGGCTATTGTTCGGAAGCTGTGCG

TTTGTGGGATGTGCTTAGAGTCGACCTCGATCCCTCCACATGGAGACATAATTGTGGAAAGAAGCCATCGGATGCCCTGAGAGTGTGCTTGCACTTGCCC

AGGCTCTTAGTCCCGGTCCTTCGGTGGCAGTGACTTGGGGCATCGGAAACATTAGACAGTCCCCAATGAATGGAGCCTATAGTTTTTAATCTTATCCCCC

CCTTTCTTATTTTGTATGTGTGTTGGGGCGAGGGCAAAGGATTTACCTTCGTGTTATATGTTTCTCAGGTTAACAAAGTTATTTTGGGTTCTCTGCCGTG

CCTGCAGGTGTTAGGGAGAGCCTGGGTGTTGTATGTGGCAGGAAAAAAGCAATTGTTTCTGACTCCTTAGCTACCTTGAAGACCTCTGTATGTTTGCCGA

AGAGTTGAGGGGACACACCACCCGCATAGCATGAGTGACTCCTAAGTCAGAGCAGACATGGGTGAGCACGTTAGTTTTGAGAAAGAAACTGCCTACAACA

TAATCAACCTGACAGGTCTTTGGATAGTTTTACATTTGTGTGTTGTGTTTAATGTTCAGCCTGGGCTGCAGCTTGGCGGGTATCGGGTTCTGCTTTCTGG

TTTCTAGTCTGGCTTTGAATTTACTGGGTTGCTAGCAAGAAAACAAATCTATTTTTAAGGGAATAGAATGTAGAACGGCGTAGGCGTAGAAGTATAATAC

ACAGTGACCATCATAGATTTACACAGCTTTAGAGTTCTTAGCCCCCAGGACTTCCTACATAAAAGGCCCGGGAAGCTCTAGCTGCAGGTTGCTGGTGTGC

TCAGCACAGCTTTCCTTTATGCACTCCCAGCTTATAAGGGACTTCGGTTTATTTGCGATTTGCCTTGCATGATACCACTTTGTATCTTTCAGGAGGTCAG

AGGACTCTTTTGTCCAGGTTGAAGTCCCAAAGTGTCAGTTTTACCTAAGATTGTTTCTCAACGACCCCCCCTCCCCCCGCCGCCGCCGAAGGGTCCCTGA

TTTCCATGTATCAGGAAGGTGACTGCTTCTATCTATCCATGTATATGACATTATGTACATCAAGTACTGAATCTGATTTCTGTGCCAGCCATCTGACCTG

ATTCTTTGAGACCCATAAAGGTACTGGTTATAGGTAATAGTTGCATCCCGGGAGAATAGAGTGGTCCAAATACTTTCTCTGAATTATAAAGCTAATGGGG

TTTGCATTTTAGTAAAGCGTCCTAATTGTCAGTGATGCAGGATCTTGCTTTTTAATTTTTTTTTTTTAAATACAATTCTCTAAATGTGGTCAGTAATGTA

TGGGATCAGTCACATAGTAGATGCATTCTGGATCTTCTATTGGGAAAGCCTTCATAAGGGAGGCCATATGTAAAACCACCCTGGTCCGTTTACCTTACAA

GCACCACTTATGCAGCATCTGACTCAGCATAAATCTATGGCAAAACCACAACAGTGACTCTGTCCCTTTGCGGTATACCATGCCTCGTCTGAGAGGCTCT

AATACCGGAAGAGTTTATTCTTAAAAGTAAAGATGGTTTTGTATCATAAGATAACCCCCAAAGCTGGCCACCAAGGCTTCCTTTCTCTGTTCTTCCTCTT

TCCTAACTCGGGTTTTGGAGTCTCCTTAGCTTACGCTACTTTCTTAGGACTTTGGTTTTTGTTTTTTTGTTTGTTTTTTTTTGAGCCCAGGAGTCTACAG

TGTGACCCTTGTCAGTGAAGTTCTTTTGTTTTAAAAGATTCATGGTAACACAAAATGTATTTTACTGCTACAACTAAAATGTATTTATAATAAAAAAATG

CCTTTTTAATAA
Translation
 - UNI16845 -  - UNI8619 -  - UNI2638 - - UNI17082 - MEDRRAERSCEQACASLQRQDYDMALQHCTDALLSLGQYSMADFTGP

CPVEVERIKIESLLYRIASFLQL - UNI2638 - - UNI17208 - KNYGQADEDCRHV - UNI25707 - VLGEGLAKGERAFRAVLCCMQLKG

KLQLVSSILAKSLSGESL - UNI2790 - NGMVTKDLTRLKTLLTETE - UNI5693 - TATSNVLSGCHVEDLDEG GSCNGWHFRPPPRGITSS

EEYTLCKR RFLEQGICRYGAQCTSAHSQEELAEWQKRYASRLIKLKQQSENKQLSGSYMETLIEKWMSSLSPEKV LSECIEGVQVEHSPDLSVTVNTK

KSHQTWTFALTCK PARMLYRVALLYDAHRPHFSIIAISAGDSTTQVSQEVPENCQEWIGGKMAQNGLDHYVYKVGIAFNTEIFGTFRQTIVFDFGLEPV

LMQRVMIDAASTED - UNI109 - DLEYLMHAKRQLVTTAKRWDSSSKTIVDFEPNETTDLEKSLLIRYQIPLSADQLFTQSVLDKSLTKTNYQARLH

DLLYIEEIAQYKEVSR RFNLKVQLQILASFMLTGVSGGAKYAQNGQLFGRFKLTETLSEDTLAGRLVMTRVNAVYLLPVPKEKLVQSQGTKEKVYEATI

EEKTKDYVFLRISRECCEELSLRPDCDIQ VELQFQLNRLPLCEMHYALDRIKDNAVLFPDISMTPTIPWSPNR - UNI3629 - RQWDEQLDPRLNA

KQKEAVLAITTPLSIQLPPVLIIGPYGTGKTFTLAQAAKHILQQQETR RILICTHSNSAADLYIKDYLHPYVEAGNPQARPLR RVYFRNRWVKTVHPV

VHQYCLISSTQSTFQMPQKEDILKHRVVVVTLSTSQYLCQLDLEPG GFFTHVLLDEAAQAMECETIMPLALATKNTRIVLAGDHMQ LSPFVYSEFARE

RNLHVSLLDRLYEHYPAEFPCRILLCENYRSHEAIIN NYTSELFYEGKLMASGKQPAHKDFYPLTFFTARGEDVQEKNSTAFYNNAE - UNI1063 -

 VFEVVERVEELRRKWPVAWGKLDDGSIGVVTPYADQVFRIRAELRKKRLSDVNVERVLNVQG - UNI6796 - GKQFRVLFLSTVRTRHTCKHKQTP

IKKKEQLLEDSTEDLDYGFLSNYKLLNTAITRAQSLVAVVGDPVALCSIGRCR - UNI7069 - RKFWERFIALCHENHSLHGITFEQIKAQLEALEL

KKTYVLNPLAPEFIPRALRLQHSGNSSRQQQSPPK - UNI28056 - VKSLYHPQSDHFQSDGIV VQPNPSVLIGNPIRAYTPPPPLGPHPNLGKSP

SPVQRIDPHTGTSILYVPAVYGGNVVMSVPLP VPWTGYQGRFAVDPRIITHQAAMAYNMNLLHTHGRGSPIPYGLGHHPPVSLGQPQSQHAEKDQQEQN

RNG GKTDTNNPGPEINKIRTPEKKPTEPKQ - UNI7618 - VDLESNPQNRSPESRPGVVYSNTKFPRKDHLNPRHINNLPLPAPHAQYAIPSRHFH

PLPQLPRPPFPASQPHTLLNQQQNNLPEQPNQMAPQPNQVAPQPNQMTPQPNQVAPQPNQVVQQQSQAPPQAPQPAPQLSPAFQAGPTNAFFNNAVAHRP

QSPAAEAVGPEQPPPPGLPDGHSPLRAITQPGPILASPLNNFVDESSPGLPIEEALD - UNI3079 - DGVHGSVALETLRQQQARLQQWSEHHAYLS

QGGIPYSHHHHPHLPHLPHTPIGLHQPPVRAEWKVAGRADDETETTFSR RFQDLLRELSHRDQGDTGELAEMPPPQSRLLQYRQVQPRSPPAVPSPPSS

TDHSSQFANFNDSSRDIEVANSPAFPQRLPPQLFGSPFSLPSEHLAPPPLKYLAPEGAWNFANLQQNHLIGPGFPYGLPPLPPRPPQNPFIHIQNHQHAA

GQEPFHPLSSRTVSASSLPSLEE - UNI18935 - YEPRGPGRPLYQRRISSSSAQPCVEEASAPQDSLAQGKESQGHSNPPAFNFPAPESWANTTSS

APYQNIPCNGSSRTSQPRELIA - UNI6640 - APPKTVKPPEDQLKPESGEVSSSFNYSMLQHLGQFPPLMPNKQIAESANCSSQQSPAGSKPAMSY

ASALRAPPKPRPPPEQAKKGSDPLSLLQELSLGSSPGSNGFYSYFK
Transcript ENSMUST00000100305
Sequence
CAAGATGGCGTAGAAAGTAATGACAG - UNI16845 - GAACTGGATGAAGTAATTGATCACTAATGAACTACAGAGCCGGTGAGATGTGCAAG - U

NI8619 - AAATTATAAAGAGCTCTGATGGGCTATTTGGGTGTTACCCAGTGCAGTGAACTGCAG - UNI2638 - - UNI17082 - GATTTTTG

TCCCTGAGTCATGGAAGACAGAAGAGCTGAAAGGTCATGTGAACAAGCGTGCGCGTCACTGCAGAGGCAGGACTATGACATGGCCCTCCAGCACTGCACC

GACGCCCTGCTCTCTCTTGGCCAGTACTCCATGGCAGACTTCACAGGGCCGTGCCCGGTGGAGGTTGAGCGCATCAAAATTGAGAGTCTTCTTTACAGAA

TTGCCTCATTCTTGCAATTG - UNI2638 - - UNI17208 - AAAAACTACGGGCAAGCTGATGAAGATTGTAGGCATG - UNI25707 - TGC

TGGGGGAAGGACTGGCCAAGGGAGAGCGTGCCTTCCGGGCAGTGCTGTGCTGCATGCAGCTGAAAGGGAAGCTCCAGCTTGTGTCCTCCATCCTTGCCAA

GTCACTGTCAGGGGAGTCTCTG - UNI2790 - AATGGGATGGTAACGAAAGATTTGACAAGACTAAAGACACTTCTCACAGAAACAGAG - UNI56

93 - ACAGCAACGAGTAATGTCCTGTCTGGATGTCACGTAGAAGACTTAGATGAAG GGTCCTGTAATGGTTGGCATTTCCGCCCACCGCCCAGGGGCA

TCACCAGCAGTGAGGAGTACACCTTGTGTAAGAG GTTTTTAGAGCAAGGGATCTGTAGGTACGGTGCCCAGTGTACTTCAGCACATTCCCAGGAAGAGC

TAGCAGAGTGGCAGAAAAGATACGCCTCCCGACTGATCAAACTGAAGCAGCAAAGTGAGAATAAACAGCTCTCAGGCAGCTACATGGAGACCTTGATAGA

GAAGTGGATGAGTTCACTGTCTCCTGAGAAAGTG CTTAGTGAATGCATAGAGGGAGTTCAGGTGGAGCACAGCCCTGACCTGTCGGTCACCGTCAACAC

CAAAAAATCCCACCAGACGTGGACCTTTGCTCTGACCTGTAAG CCTGCAAGAATGCTGTATCGGGTAGCCTTGCTTTATGACGCTCATCGTCCTCATTT

CAGTATCATTGCCATATCTGCCGGAGATAGTACTACCCAGGTATCACAAGAAGTCCCCGAGAACTGTCAAGAATGGATAGGAGGAAAGATGGCCCAAAAT

GGATTAGATCATTACGTGTATAAAGTCGGGATAGCATTTAACACAGAAATATTTGGAACTTTTCGCCAAACCATAGTTTTCGACTTTGGATTGGAGCCAG

TACTCATGCAGAGGGTGATGATTGACGCAGCTTCTACAGAAG - UNI109 - ATCTTGAATACCTGATGCATGCAAAGCGGCAGCTGGTAACCACAGC

CAAGCGCTGGGACTCTTCTTCTAAGACTATTGTAGATTTTGAACCTAATGAAACTACTGATTTGGAGAAGAGCCTTTTGATCAGATACCAAATTCCTCTG

TCTGCTGACCAGCTGTTTACACAGTCCGTCTTAGACAAATCATTGACCAAGACTAACTATCAGGCACGGCTGCACGACCTGCTTTATATTGAGGAGATAG

CCCAGTATAAAGAAGTCAGCAG GTTCAACCTTAAAGTGCAATTGCAGATTTTAGCAAGCTTCATGCTCACTGGAGTTTCTGGGGGTGCAAAGTATGCTC

AGAATGGACAACTTTTTGGTCGTTTCAAGCTTACTGAAACCCTCTCGGAAGACACTTTGGCTGGACGGCTGGTGATGACCAGGGTCAATGCTGTTTATTT

ATTACCAGTCCCTAAAGAGAAGCTCGTTCAGTCCCAGGGAACCAAAGAGAAGGTTTATGAAGCTACTATTGAAGAAAAAACAAAAGACTATGTATTTTTA

AGGATATCCAGGGAATGCTGTGAAGAGCTTAGTCTGCGGCCTGACTGTGACATCCAG GTTGAGCTTCAGTTTCAGTTGAACCGATTACCCCTCTGTGAA

ATGCATTATGCACTAGACAGGATTAAGGACAATGCTGTTTTGTTTCCAGACATCAGTATGACTCCTACCATACCTTGGAGTCCCAACAG - UNI3629 

- ACAGTGGGACGAGCAGTTGGATCCTCGGCTAAATGCAAAGCAGAAAGAAGCTGTTCTGGCCATCACCACTCCACTCTCCATCCAGCTGCCGCCTGTCC

TCATCATTGGACCCTACGGGACGGGCAAAACCTTCACTCTGGCTCAGGCGGCCAAGCACATACTGCAGCAGCAGGAGACCAG GATTCTCATTTGCACCC

ATTCTAATAGTGCTGCTGACCTCTACATAAAGGATTATTTACATCCATATGTAGAAGCAGGCAATCCCCAGGCAAGACCTCTCAG GGTGTATTTCCGGA

ATCGCTGGGTGAAGACTGTCCACCCAGTCGTGCATCAGTACTGCTTGATCTCGAGCACACAGTCCACCTTTCAGATGCCCCAGAAGGAAGATATTCTTAA

ACATCGAGTGGTGGTGGTCACACTGAGCACTTCCCAGTACCTCTGCCAGCTGGACCTGGAACCTG GGTTCTTCACGCACGTTCTCTTAGATGAAGCTGC

CCAGGCCATGGAGTGTGAGACCATTATGCCTCTAGCCTTAGCTACTAAAAACACACGGATTGTTTTGGCTGGTGATCACATGCAG CTCAGCCCTTTTGT

TTACAGCGAGTTTGCCAGGGAGAGAAACCTTCACGTTTCGTTACTTGACCGACTCTACGAGCATTACCCTGCTGAGTTTCCATGCAGGATCCTCCTCTGT

GAGAACTATCGTTCCCATGAAGCTATCATCAA CTACACCTCTGAGCTTTTCTATGAGGGGAAGCTGATGGCCAGTGGGAAGCAGCCGGCGCACAAGGAC

TTCTATCCACTCACGTTCTTTACGGCACGGGGGGAGGACGTCCAAGAGAAGAACAGCACGGCATTCTACAACAATGCAGAG - UNI1063 - GTATTT

GAAGTGGTGGAGCGTGTAGAAGAGCTAAGACGGAAGTGGCCAGTGGCATGGGGAAAGTTAGATGACGGCAGCATCGGTGTGGTGACGCCATACGCTGACC

AGGTGTTTAGAATCCGAGCTGAGCTTCGGAAGAAGAGGCTCTCGGATGTGAATGTGGAAAGGGTGCTCAATGTCCAAG - UNI6796 - GAAAGCAGT

TCAGAGTTCTGTTTCTTAGCACAGTGCGTACACGCCACACTTGCAAGCACAAGCAGACGCCAATTAAAAAGAAAGAGCAACTCCTGGAAGACTCCACCGA

GGACTTAGATTATGGTTTTCTATCCAACTACAAACTTCTCAATACGGCCATCACCAGAGCACAGTCCTTGGTTGCTGTGGTGGGTGACCCTGTTGCTCTG

TGCTCTATTGGAAGGTGTAG - UNI7069 - AAAGTTTTGGGAGCGGTTTATTGCCCTGTGTCATGAAAACCACAGCTTGCACGGGATCACGTTCGAA

CAGATCAAGGCACAGTTAGAGGCTTTAGAACTCAAGAAGACTTACGTGTTGAATCCACTGGCTCCTGAGTTTATCCCCCGGGCTTTACGACTGCAGCATT

CAGGAAACAGTAGCAGACAGCAGCAGTCACCACCCAAG - UNI28056 - GTGAAAAGCCTCTATCATCCCCAGAGTGATCATTTCCAGAGTGATGGA

ATTG TTCAGCCCAATCCTTCCGTACTTATTGGCAATCCTATTAGAGCATATACTCCTCCGCCCCCTCTTGGACCGCACCCAAACTTGGGAAAATCTCCA

AGCCCCGTTCAAAGAATAGATCCTCACACTGGGACTAGTATTCTTTACGTACCTGCTGTCTATGGAGGAAATGTAGTTATGTCGGTGCCTTTACCT GTG

CCATGGACAGGGTACCAGGGTAGGTTTGCAGTTGACCCTCGGATTATCACACACCAGGCAGCAATGGCCTACAATATGAACCTATTACACACACACGGAC

GTGGGTCACCGATCCCTTATGGTCTTGGCCATCACCCACCTGTCAGCCTAGGCCAGCCACAGAGTCAGCACGCAGAGAAGGATCAGCAGGAGCAAAACCG

AAATG GTAAAACTGATACAAATAACCCTGGACCTGAAATTAATAAGATCCGAACACCAGAGAAGAAACCTACAGAGCCCAAGCAG - UNI7618 - G

TTGATTTGGAATCAAATCCACAGAACAGAAGTCCTGAATCCCGTCCTGGTGTTGTTTATTCCAACACTAAATTTCCTCGAAAAGATCATCTCAACCCAAG

ACACATAAATAATCTCCCTCTTCCTGCACCACACGCCCAGTATGCAATCCCTAGCCGCCATTTTCACCCGCTGCCTCAGCTGCCCAGGCCGCCGTTTCCC

GCTTCCCAGCCGCACACCTTGTTAAATCAGCAACAGAATAATTTGCCTGAACAACCAAATCAGATGGCACCTCAGCCAAATCAGGTGGCACCCCAGCCAA

ATCAGATGACACCCCAGCCAAATCAGGTGGCACCCCAGCCAAATCAGGTGGTCCAGCAGCAGAGCCAGGCACCTCCACAGGCCCCACAGCCAGCACCTCA

ACTCTCTCCTGCATTTCAGGCGGGGCCCACCAATGCATTTTTCAATAATGCAGTTGCTCACCGACCACAGTCTCCTGCTGCAGAGGCTGTGGGTCCTGAG

CAGCCGCCCCCTCCCGGGCTGCCCGATGGCCACAGTCCACTGAGAGCCATCACACAGCCTGGCCCCATCCTGGCATCACCTTTGAACAACTTTGTTGATG

AGAGCTCTCCAGGATTGCCTATAGAAGAAGCTTTGG - UNI3079 - ATGGAGTGCATGGAAGCGTAGCTCTGGAGACGCTGAGGCAGCAGCAGGCGC

GGCTACAGCAGTGGAGTGAGCACCATGCCTACCTGAGCCAGGGCGGCATCCCCTATTCACACCATCACCATCCTCACCTCCCGCATCTTCCCCACACACC

CATTGGCCTCCACCAGCCACCAGTGAGGGCAGAGTGGAAAGTCGCCGGCAGGGCTGACGATGAAACAGAGACAACATTCTCAAGGTATTCCAGCAGGCCA

GGGCCAGCCCTGATCACTACCTGCGTGTGGTCTGCCTCACTGTAGCCTTTTAGCTTCAGATTGGAAGACGCTCTCAAGTGACCCTGGTGTGGGCCTTGGC

GGTTGCTACAGTTCTCTTAGTTGACTCTAAAATATGGAGAATTTAGAACGCGCTCTCATTACAATCTGGGCCGAATCTACACTTTTGCTTTATGATCTGT

TATGCAAAAGAAACTGTCACTGGGTATGGGTGTTTTTATTGTTTGTTTGTTTACTTAGTAAATAAAAGGATAATGGGGACAGAAGTCAATTTGTAGTTAA

AACTTAAAAACTATGAGTTTCTTACTAACTTTCTATCAAGTAGGCAGATACTTTTCGGGAGCTGCAGGTGTTCTCGGGGTTCATGCCTAACTGACTGTAT

TTGTGGCCAGCATCATGTGACTTAGTATGAACGGCTTCTTCATCCCCTCTGAACAACGCCCACTGTTACTGTGGCCCTTTAAGGTTTTTTATTCATTTTT

GTTTTGTTTTGTTTTAACATTTTTTTCTATTTTTATTTTTTATTTTTATTTTTCCTTAAATTTCATGTGTATGAGTATTTTGCCTACTGCATGGTCTGAG

TACTGTGTGCATGGCTGGTGCCTGAGGAAGCCAGAAGTGGGCATTGGATCCCCTAGAGTTACAGGTGGTTGGGAGCCACCACATGGGTGCTGAGACCTGA

ACCTGAGTCCTCTGTAAGAGCGCAAGTGTCCTTAACTGGTGAGCTCTCTCTCCAGCCTCTTAGTTACTGATTTTGTGTATGTGTATGTGTGTGTGTGTGT

GTGAGTGTGGGGTCAGAAGACAGCCCACGGGGTGTTGGTCCTTCTACAGTGTGTCTTCCAGGGCTCACCTTGTCAGATTTAGTGGCCAGCATCTATATCT

GCTGAGCTGTCTCCCTATCCCTTTCCAGTTTTTATGTTGAAGCAAGAATGGATCTTTTCATGCAAAGGTTAAAAACAACAACAACAAAGC
Translation
 - UNI16845 -  - UNI8619 -  - UNI2638 - - UNI17082 - MEDRRAERSCEQACASLQRQDYDMALQHCTDALLSLGQYSMADFTGP

CPVEVERIKIESLLYRIASFLQL - UNI2638 - - UNI17208 - KNYGQADEDCRHV - UNI25707 - VLGEGLAKGERAFRAVLCCMQLKG

KLQLVSSILAKSLSGESL - UNI2790 - NGMVTKDLTRLKTLLTETE - UNI5693 - TATSNVLSGCHVEDLDEG GSCNGWHFRPPPRGITSS

EEYTLCKR RFLEQGICRYGAQCTSAHSQEELAEWQKRYASRLIKLKQQSENKQLSGSYMETLIEKWMSSLSPEKV LSECIEGVQVEHSPDLSVTVNTK

KSHQTWTFALTCK PARMLYRVALLYDAHRPHFSIIAISAGDSTTQVSQEVPENCQEWIGGKMAQNGLDHYVYKVGIAFNTEIFGTFRQTIVFDFGLEPV

LMQRVMIDAASTED - UNI109 - DLEYLMHAKRQLVTTAKRWDSSSKTIVDFEPNETTDLEKSLLIRYQIPLSADQLFTQSVLDKSLTKTNYQARLH

DLLYIEEIAQYKEVSR RFNLKVQLQILASFMLTGVSGGAKYAQNGQLFGRFKLTETLSEDTLAGRLVMTRVNAVYLLPVPKEKLVQSQGTKEKVYEATI

EEKTKDYVFLRISRECCEELSLRPDCDIQ VELQFQLNRLPLCEMHYALDRIKDNAVLFPDISMTPTIPWSPNR - UNI3629 - RQWDEQLDPRLNA

KQKEAVLAITTPLSIQLPPVLIIGPYGTGKTFTLAQAAKHILQQQETR RILICTHSNSAADLYIKDYLHPYVEAGNPQARPLR RVYFRNRWVKTVHPV

VHQYCLISSTQSTFQMPQKEDILKHRVVVVTLSTSQYLCQLDLEPG GFFTHVLLDEAAQAMECETIMPLALATKNTRIVLAGDHMQ LSPFVYSEFARE

RNLHVSLLDRLYEHYPAEFPCRILLCENYRSHEAIIN NYTSELFYEGKLMASGKQPAHKDFYPLTFFTARGEDVQEKNSTAFYNNAE - UNI1063 -

 VFEVVERVEELRRKWPVAWGKLDDGSIGVVTPYADQVFRIRAELRKKRLSDVNVERVLNVQG - UNI6796 - GKQFRVLFLSTVRTRHTCKHKQTP

IKKKEQLLEDSTEDLDYGFLSNYKLLNTAITRAQSLVAVVGDPVALCSIGRCR - UNI7069 - RKFWERFIALCHENHSLHGITFEQIKAQLEALEL

KKTYVLNPLAPEFIPRALRLQHSGNSSRQQQSPPK - UNI28056 - VKSLYHPQSDHFQSDGIV VQPNPSVLIGNPIRAYTPPPPLGPHPNLGKSP

SPVQRIDPHTGTSILYVPAVYGGNVVMSVPLP VPWTGYQGRFAVDPRIITHQAAMAYNMNLLHTHGRGSPIPYGLGHHPPVSLGQPQSQHAEKDQQEQN

RNG GKTDTNNPGPEINKIRTPEKKPTEPKQ - UNI7618 - VDLESNPQNRSPESRPGVVYSNTKFPRKDHLNPRHINNLPLPAPHAQYAIPSRHFH

PLPQLPRPPFPASQPHTLLNQQQNNLPEQPNQMAPQPNQVAPQPNQMTPQPNQVAPQPNQVVQQQSQAPPQAPQPAPQLSPAFQAGPTNAFFNNAVAHRP

QSPAAEAVGPEQPPPPGLPDGHSPLRAITQPGPILASPLNNFVDESSPGLPIEEALD - UNI3079 - DGVHGSVALETLRQQQARLQQWSEHHAYLS

QGGIPYSHHHHPHLPHLPHTPIGLHQPPVRAEWKVAGRADDETETTFSRYSSRPGPALITTCVWSASL

For any suggestions or comments, please send an email to unitrap@crg.es