Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020743 (Mif4gd)
Chromosomal location
Chr 11: 115469232 - 115474236 (-)
Description
MIF4G domain containing Gene [Source:MGI (curated);Acc:Mif4gd-001]
RefSeq_dna
NM_027162 
RefSeq_peptide
NP_081438.3 
UniGene
Mm.390387 
MGI
MGI:1916924 
Uniprot/SWISSPROT
Q3UBZ5 
Uniprot/SPTREMBL
Q8BTE1 A2A9W1 A2A9W3 
Human Ortholog
ENSG00000125457 (MIF4GD)
Omim not available
UniTrap UNI14322
Vector Insertion
Chr 11: 115473216 - 115474193
Public Clones FHCRC-GT-S13-10E1 (fhcrc) FHCRC-GT-S19-5D1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20131
Vector Insertion
Chr 11: 115473216 - 115473349
Public Clones not available
Private Clones OST371959 (lexicon) OST309293 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22703
Vector Insertion
Chr 11: 115470963 - 115473216
Public Clones (sanger) IST10012B2 (tigm)
Private Clones OST287368 (lexicon) OST179087 (lexicon) OST113255 (lexicon) OST39483 (lexicon)
OST37851 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24368
Vector Insertion
Chr 11: 115470750 - 115470852
Public Clones IST14329A8 (tigm)
Private Clones OST223280 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021087
Sequence
CTAGTTCACCTGAGCGGGGCAAGGGATATGGTGACCCCGGCGCGGGGTGCGACCTGGCAAGACCAACAACTTCACGCAAAACGCAGGGAGGGTCCGGCCC

AGCGCTCGGAGGCTTTCGTGGTCAGAAACAAGGCGGAG - UNI14322 - - UNI20131 - GTGCTGTCCTTAGTTTCAGGCCAGTGAAAACCTGC

CGGGCTTAGACCGTCATGAGCGAGGCCAGTAGAGATGATTATAAAATCCAGTCTTTTGATGCAGAGACGCAGCAGCTGCTGAAGACCGCGCTCAAAG - 

UNI14322 - - UNI20131 - - UNI22703 - ATCCAGGTGCTGTGGACTTAGAGAGAGTAGCCAACGTGATTGTGGACCATTCTCTGCAGGACT

GTGTATTCAGCAAGGAAGCAGGACGCATGTGCTACGCCATCATTCAG - UNI24368 - GCAGAGAGTAAGCAAGCGGGCCAGAGCGTCTTCCGCCGT

GGGCTCCTCAACCGGCTGCAGAAGGAGTATGATGCGCGGGAGCAGCTCCGAGCATGCTCCCTGCAGGGCTGGGTCTGCTATGTCACCTTTATCTGCAACA

TCTTTGACTACCTGAGG GTGAACAACATGCCCATGATGGCCCTGGTTAACCCTGTCTATGACTGTCTCTTCCAGCTGGCCCAGCCTGAGAGTCTGAGCA

GGGAAGAGGAG GTGGACTGCCTGGTGCTGCAGCTGCACCGGGTCGGGGAGCAGCTGGAGAAGATGAACGGGCAGCGCATGGATGAGCTCTTTATCCTAA

TCCGGGACGGCTTCCTGCTCCCGACAGACCTCAGCTCCCTGGCACGGCTGCTGCTGCTGGAGATGATTGAGTTCCGGGCAGCTGGCTGGAAGACCACTCC

TGCTGCCCACAAGTATTACTACAGTGAGGTCTCTGACTAAGCCCAGGTCTGCACATGCCTTCCCGTGACCCTCTTTTCAAGCTGGCACCAGAATCCTTGC

TTCAGCCCCTTCTAGACTTTTTTGACTGCTGTGGTTCTGCCGTCTTCCCTTCCCTCAATCTGGACTTGTCTCCTGGCTGAAGACTGACTGTCTTCCTCTC

CCCTCAAGTCCTGTTATCTTCCCACCACCTTCCTCCTGGGCCTGACAGGGGAGAACCAACTAACAAACACTGAACTGTGTAGCCACTGGTGCAACATGAC

CTTGGTGCCTCAGTTTTCCTGTCTATAAAATGGGCAATTTTAGCCATTGGTGGAATGCTTTGGGATGTTAAGGGCAAGTTACAAGAAATGGTGTTTTATA

TATTTTATAGAGAGACTTTTGTGGAGGAAGCCTGTTTCCTCCAGTCATGAGTGACTGCCTCACCAGGTTGGGGTGAGGGTTTTCTAATAAATCTTTTCTG

AAACC
Translation
 - UNI14322 - - UNI20131 - MSEASRDDYKIQSFDAETQQLLKTALKD - UNI14322 - - UNI20131 - - UNI22703 - DPGAV

DLERVANVIVDHSLQDCVFSKEAGRMCYAIIQ - UNI24368 - AESKQAGQSVFRRGLLNRLQKEYDAREQLRACSLQGWVCYVTFICNIFDYLR V

NNMPMMALVNPVYDCLFQLAQPESLSREEE VDCLVLQLHRVGEQLEKMNGQRMDELFILIRDGFLLPTDLSSLARLLLLEMIEFRAAGWKTTPAAHKYY

YSEVSD
Transcript ENSMUST00000106507
Sequence
GGGGTGGACGGACTGGAAACGCTGGGAGAGAGGGGCTCGGAGCCCTGCTGGTATCAGGATCTGCGGCTTGGACTGAGCCAGCGTCCTCCGTGCTAGACGA

TAAAGGCGAGCCTGACGTTTACACCCAGTTCAGTATTTGCACCCCGAAATTTACCCTGATACTGACTGTATCAGATCCCAGATCTGGGATAACTCAGATC

CCGCTGGGACCGTAGGTGAATTCCCGCTTCACTTCTCAGATGTAACCCCAGAAGCCTGGGTTTCCTTCAGCTGAGCAGCAGGTGGCCACTTGGTGCTCAA

CTACTCCACCCGAAGCCAAGTTTGGTGGGCACTCAGCCAAGCACTGAACGCGACAGAAAGTCCAGTTCCACCCGTCCCAAGGCCTGGTCTGCCCGGCCCA

GTGCCTACAGGGCTAGAATCGGGAGCTTTGTGATTCACCCTTGAAGCCTCAACCGTCTTTGCTTCTCAGGTGCTGTCCTTAGTTTCAGGCCAGTGAAAAC

CTGCCGGGCTTAGACCGTCATGAGCGAGGCCAGTAGAGATGATTATAAAATCCAGTCTTTTGATGCAGAGACGCAGCAGCTGCTGAAGACCGCGCTCAAA

G - UNI14322 - - UNI20131 - - UNI22703 - ATCCAGGTGCTGTGGACTTAGAGAGAGTAGCCAACGTGATTGTGGACCATTCTCTGCAG

GACTGTGTATTCAGCAAGGAAGCAGGACGCATGTGCTACGCCATCATTCAG - UNI24368 - GCAGAGAGTAAGCAAGCGGGCCAGAGCGTCTTCCG

CCGTGGGCTCCTCAACCGGCTGCAGAAGGAGTATGATGCGCGGGAGCAGCTCCGAGCATGCTCCCTGCAGGGCTGGGTCTGCTATGTCACCTTTATCTGC

AACATCTTTGACTACCTGAGG GTGAACAACATGCCCATGATGGCCCTGGTTAACCCTGTCTATGACTGTCTCTTCCAGCTGGCCCAGCCTGAGAGTCTG

AGCAGGGAAGAGGAG GTGGACTGCCTGGTGCTGCAGCTGCACCGGGTCGGGGAGCAGCTGGAGAAGATGAACGGGCAGCGCATGGATGAGCTCTTTATC

CTAATCCGGGACGGCTTCCTGCTCCCGACAGACCTCAGCTCCCTGGCACGGCTGCTGCTGCTGGAGATGATTGAGTTCCGGGCAGCTGGCTGGAAGACCA

CTCCTGCTGCCCACAAGTATTACTACAGTGAGGTCTCTGACTAAGCCCAGGTCTGCACATGCCTTCCCGTGACCCTCTTTTCAAGCTGGCACCAGAATCC

TTGCTTCAGCCCCTTCTAGACTTTTTTGACTGCTGTGGTTCTGCCGTCTTCCCTTCCCTCAATCTGGACTTGTCTCCTGGCTGAAGACTGACTGTCTTCC

TCTCCCCTCAAGTCCTGTTATCTTCCCACCACCTTCCTCCTGGGCCTGACAGGGGAGAACCAACTAACAAACACTGAACTGTGTAGCCACTGGTGCAACA

TGACCTTGGTGCCTCAGTTTTCCTGTCTATAAAATGGGCAATTTTAGCCATTGGTGGAATGCTTTGGGATGTTAAGGGCAAGTTACAAGAAATGGTGTTT

TATATATTTTATAGAGAGACTTTTGTGGAGGAAGCCTGTTTCCTCCAGTCATGAGTGACTGCCTCACCAGGTTGGGGTGAGGGTTTTCTAATAAATCTTT

TCTGAAACCAAA
Translation
MSEASRDDYKIQSFDAETQQLLKTALKD - UNI14322 - - UNI20131 - - UNI22703 - DPGAVDLERVANVIVDHSLQDCVFSKEAGRMC

YAIIQ - UNI24368 - AESKQAGQSVFRRGLLNRLQKEYDAREQLRACSLQGWVCYVTFICNIFDYLR VNNMPMMALVNPVYDCLFQLAQPESLSR

EEE VDCLVLQLHRVGEQLEKMNGQRMDELFILIRDGFLLPTDLSSLARLLLLEMIEFRAAGWKTTPAAHKYYYSEVSD
Transcript ENSMUST00000106506
Sequence
GGGTGCGACCTGGCAAGACCAACAACTTCACGCAAAACGCAGGGAGGGTCCGGCCCAGCGCTCGGAGGCTTTCGTGGTCAGAAACAAGGCGGAG - UNI

14322 - - UNI20131 - GTGCTGTCCTTAGTTTCAGGCCAGTGAAAACCTGCCGGGCTTAGACCGTCATGAGCGAGGCCAGTAGAGATGATTATAA

AATCCAGTCTTTTGATGCAGAGACGCAGCAGCTGCTGAAGACCGCGCTCAAAG - UNI14322 - - UNI20131 - - UNI22703 - ATCCAGG

TGCTGTGGACTTAGAGAGAGTAGCCAACGTGATTGTGGACCATTCTCTGCAGGACTGTGTATTCAGCAAGGAAGCAGGACGCATGTGCTACGCCATCATT

CAG - UNI24368 - GCAGAGAGTAAGCAAGCGGGCCAGAGCGTCTTCCGCCGTGGGCTCCTCAACCGGCTGCAGAAGGAGTATGATGCGCGGGAGCA

GCTCCGAGCATGCTCCCTGCAGGGCTGGGTCTGCTATGTCACCTTTATCTGCAACATCTTTGACTACCTGAGG CTGGCCCAGCCTGAGAGTCTGAGCAG

GGAAGAGGAG GTGGACTGCCTGGTGCTGCAGCTGCACCGGGTCGGGGAGCAGCTGGAGAAGATGAACGGGCAGCGCATGGATGAGCTCTTTATCCTAAT

CCGGGACGGCTTCCTGCTCCCGACAGACCTCAGCTCCCTGGCACGGCTGCTGCTGCTGGAGATGATTGAGTTCCGGGCAGCTGGCTGGAAGACCACTCCT

GCTGCCCACAAGTATTACTACAGTGAGGTCTCTGACTAAGCCCAGGTCTGCACATGCCTTCCCGTGACCCTCTTTTCAAGCTGGCACCAGAATCCTTGCT

TCAGCCCCTTCTAGACTTTTTTGACTGCTGTGGTTCTGCCGTCTTCCCTTCCCTCAATCTGGACTTGTCTCCTGGCTGAAGACTGACTGTCTTCCTCTCC

CCTCAAGTCCTGTTATCTTCCCACCACCTTCCTCCTGGGCCTGACAGGGGAGAACCAACTAACAAACACTGAACTG
Translation
 - UNI14322 - - UNI20131 - MSEASRDDYKIQSFDAETQQLLKTALKD - UNI14322 - - UNI20131 - - UNI22703 - DPGAV

DLERVANVIVDHSLQDCVFSKEAGRMCYAIIQ - UNI24368 - AESKQAGQSVFRRGLLNRLQKEYDAREQLRACSLQGWVCYVTFICNIFDYLR L

AQPESLSREEE VDCLVLQLHRVGEQLEKMNGQRMDELFILIRDGFLLPTDLSSLARLLLLEMIEFRAAGWKTTPAAHKYYYSEVSD

For any suggestions or comments, please send an email to unitrap@crg.es