Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020758 (Itgb4)
Chromosomal location
Chr 11: 115836023 - 115869726 (+)
Description
integrin beta 4 Gene [Source:MGI (curated);Acc:Itgb4-001]
RefSeq_dna
NM_001005608 
RefSeq_peptide
NP_001005608.2 NP_598424.2 
UniGene
Mm.213873 
MGI
MGI:96613 
Uniprot/SPTREMBL
A2A863 Q3USM4 Q66JU8 A2A866 A2A864 A2A865 Q3ULT5 Q3UNP2 Q6PCS0 Q8R3J1 Q91W15 
Human Ortholog
not available
Omim not available
UniTrap UNI34465
Vector Insertion
Chr 11: 115850334 - 115851035
Public Clones IST14157F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106461
Sequence
GGACTGACCCAGCTGGGCTCACTGTATTAAGAAGCGGACCCGCGACCCGGAGCGGCCCGGGGACCCGATCTGGGAGCCTGGACGGGTGGGGAAGACGGAG

CCCCGGTCTGTGCTGCAGGGAAGAGTGGCTCCTCCTCCAGCCCCCTCCGCGGCGGCTCGGGGCTCGGGGCCGGCGCCGGTTGAGCCGCAGCCCTTTCCGG

GGGGCGGGCCTGGCGGCTGCGGCGACACCCCAGCTCCTGCCCCGACAGGTGCGCGCAGCGCGCAGGAATGCAGTCCGCCTGACTCACCAGCGCCTCCTTC

CTACCTGCGCCGCCCGTCCATAAAGCGCTGCTGGCTCCCGCCCGCCGCCGCCCGCCCTGCTGTCCCGCCGGGCTCGCCCGCGCGCTCAGCTCGACCCAAC

GCAGCCCAAGTCCGAGGTAGTCTCACTAAG GAGGAGGAGGATGGCAGGGCCCTGTTGCAGCCCATGGGTGAAGCTGCTGCTGCTGGCAGCAATGCTGAG

TGCCAGCCTCCCTGGAGACCTGG CCAACCGCTGCAAGAAGGCTCAGGTGAAGAGCTGTACCGAGTGCATCCGGGTGGACAAGAGCTGTGCCTACTGCAC

AGACGAG CTGTTCAAGGAGAGGCGCTGCAACACCCAGGCGGAGCTTCTGGCTGCAGGCTGCAGGGGAGAGAGCATCCTGGTCATGGAGAGCAGCCTTGA

AATCACAGAG AACACCCAGATCGACACCAGCCTGCACCGCAGCCAGGTATCTCCCCAAGGCCTGCAAGTCCGGCTGCGGCCGGGTGAGGAGCGCAGCTT

TGTGTTCCAGGTGTTTGAGCCCCTGGAGAGCCCCGTGGATCTGTATATCCTCATGGACTTCTCCAACTCCATGTCTGACGATCTGGACAACCTCAAGCAG

ATGGGGCAGAACCTGG CCAAGATCCTGCGCCAGCTCACCAGCGACTACACCATTGGATTTGGAAAGTTTGTGGACAAAGTCAGCGTCCCACAGACAGAC

ATGAGGCCCGAGAA ACTGAAGGAGCCCTGGCCCAACAGTGATCCCCCGTTCTCCTTCAAGAACGTTATCAGCTTAACGGAGAATGTGGAAGAATTCTGG

AACAAACTGCAAGGAGAACGCATCTCAGGCAACCTGGACGCTCCTGAAGGGGGCTTTGATGCCATCCTGCAGACAGCTGTGTGCACA AGGGACATTGGC

TGGAGGGCTGACAGCACCCACCTGCTGGTGTTCTCCACCGAGTCTGCCTTCCACTACGAGGCTGATGGTGCCAACGTGCTGGCCGGCATCATGAACCGCA

ATGATGAGAAATGCCACCTGGACGCCTCGGGCGCCTACACCCAATACAAGACACAGGACTACCCATCAGTGCCCACGCTGGTTCGCCTGCTTGCCAAGCA

TAACATCATCCCCATCTTTGCTGTCACCAACTACTCTTACAGCTACTATGAG AAGCTCCATAAGTATTTCCCCGTCTCCTCTCTGGGCGTCCTGCAGGA

GGATTCATCCAACATCGTGGAGCTGCTGGAGGAGGCCTTCTAT CGAATTCGCTCCAACCTGGACATCCGGGCTCTGGACAGCCCCAGAGGCCTGAGAAC

AGAGGTCACCTCCGATACTCTCCAGAAGACGGAGACTGGGTCCTTTCACATCAAGCGGGGGGAAGTG GGCACATACAATGTGCATCTCCGGGCAGTGGA

GGACATAGATGGGACACATGTGTGCCAGCTGGCTAAAGAAGACCAAGGGGGCAACATCCACCTGAAACCCTCCTTCTCTGATGGCCTCCGGATGGACGCG

AGTGTGATCTGTGACGTGTGCCCCTGTGAGCTG CAAAAGGAAGTTCGATCAGCTCGCTGTCACTTCAGAGGAGACTTCATGTGTGGACACTGTGTGTGC

AATGAGGGCTG GAGTGGCAAAACCTGCAACTGCTCCACCGGCTCTCTGAGTGACACACAGCCCTGCCTGCGTGAGGGTGAGGACAAACCGTGCTCGGGC

CACGGCGAGTGCCAGTGCGGACGCTGTGTGTGCTATGGTGAAGGCCGCTACGAGGGTCACTTCTGCGAGTATGACAACTTCCAGTGTCCCCGGACCTCTG

GATTCCTGTGCAATG ACCGGGGTCGCTGTTCTATGGGAGAGTGTGTGTGTGAGCCTGGTTGGACAGGCCGCAGCTGTGACTGTCCCCTCAGCAATGCCA

CCTGCATCGATAGCAACGGG GGCATCTGCAACGGCCGAGGCTACTGTGAGTGTGGCCGTTGTCACTGCAACCAGCAGTCGCTCTACACGGACACCACCT

GTGAGATCAACTACTCTGCG ATACGCCTGGGTCTCTGTGAGGATCTCCGCTCCTGCGTACAGTGCCAGGCCTGGGGCACCGGGGAGAAGAAAGGGCGCG

CGTGTGACGATTGCCCCTTTAAAGTCAAGATGGTAGACGAGCTTAAGAAAG - UNI34465 - CAGAAGAGGTGGTGGAGTACTGCTCCTTCCGGGAT

GAGGATGACGACTGCACTTACAGCTACAACGTGGAGGGCGATGGCAGCCCTGGGCCCAACAGCACAGTCCTGGTCCACAAAAAGAAAG ACTGCCCTCCC

GGCTCCTTCTGGTGGCTCATCCCCCTGCTCATCTTCCTCCTGTTGCTCCTGGCGTTGCTTCTGCTGCTCTGCTGGAAATACTGTGCCTGCTGCAAA GCC

TGCCTGGGGCTTCTTCCTTGCTGCAACCGAG GTCACATGGTGGGCTTTAAGGAAGATCACTATATGCTTCGGGAGAACCTGATGGCCTCTGACCACCTG

GACACGCCCATGCTACGAAGCGGGAACCTCAAGGGACGAGACACAGTCCGCTGGAAGATCACCAACAATGTGCAGCGCCCTGGCTTTGCCACCCATGCCG

CCAGCACCAGCCCCACGGAGCTCG TACCCTACGGGCTGTCCCTGCGCCTTGGCCGCCTCTGCACTGAGAACCTTATGAAGCCGGGCACCCGAGAGTGTG

ACCAGCTACGCCAGGAGGTGGAGGAAAAT CTGAATGAGGTGTATAGACAGGTCAGCGGCGCACACAAGCTCCAGCAGACGAAGTTCCG ACAGCAGCCC

AACACCGGGAAAAA GCAAGACCACACCATTGTGGACACAGTGTTGCTGGCGCCCCGCTCCGCCAAGCAGATGCTGCTGAAGCTGACAGAGAAGCAGGTG

GAGCAGGGGTCCTTCCATGAACTGAAGGTGGCCCCTGGCTACTACACTGTCACGGCAGAGCAGG ATGCCCGGGGCATGGTGGAGTTCCAGGAGGGCGTG

GAGCTGGTGGATGTGCGAGTGCCCCTCTTCATCCGGCCTGAGGATGATGATGAGAAGCAGCTGCTGGTGGAGGCCATTGATGTCCCTGTGGGCACTGCCA

CCCTTGGTCGCCGTCTGGTAAACATCACCATTATCAAGGAACAAG CTAGTGGGGTAGTGTCCTTCGAGCAGCCTGAATACTCGGTGAGTCGTGGAGACC

AGGTGGCCCGCATCCCTGTCATCCGGCACATCCTGGACAATGGCAAGTCCCAGGTCTCCTATAGCACACAGGATAATACAGCACACGGACACCGG GATT

ATGTCCCTGTGGAGGGAGAGCTGCTGTTCCATCCTGGGGAGACCTGGAAGGAGTTGCAGGTGAAGCTACTGGAGCTGCAGGAGGTCGACTCCCTCCTGCG

TGGCCGCCAGGTCCGCCGCTTCCAAGTCCAACTCAGCAACCCCAAGTTCGGAGCCCGCCTGGGCCAGCCCAGCACAACCACCGTTATTCTCGGTGAGCAC

G ATGAAACGGACAGGAGTCTCATAAATCAAACACTTTCATCGCCTCCGCCACCCCATGGAGACCTGGGCGCCCCACAGAACCCCAATGCCAAGGCTGCC

GGGTCCAGGAAGATCCATTTCAACTGGCTGCCCCCTCCTGGCAAGCCAATGGGGTACAGG GTGAAGTACTGGATCCAGGGCGACTCTGAGTCTGAAGCC

CACCTTCTAGACAGCAAGGTGCCCTCAGTGGAACTCACCAACCTGTATCCCTATTGCGACTACGAAATGAAGGTGTGTGCCTATGGGGCACAGGGTGAGG

GGCCCTATAGCTCACTGGTGTCCTGCCGCACCCACCAGGAAG TACCCAGCGAGCCAGGGAGGCTGGCTTTCAATGTAGTCTCTTCTACGGTGACGCAGC

TGAGCTGGGCAGAGCCAGCTGAGACCAATGGCGAGATCACAGCCTACGAGGTCTGCTATGGACTGGTCAATGAGGACAACC GACCCATTGGACCTATGA

AGAAGGTGCTCGTGGACAACCCCAAGAACCGGATGCTGCTCATTGAGAATCTGCGAGAATCCCAGCCATACCGATACACGGTTAAGGCGCGCAATGGGGC

AGGATGGGGACCCGAGAGAGAGGCTATCATCAACCTGGCTACACAGCCCAAGCGGCCCATGTCCA TCCCTATCATCCCAGACATCCCCATAGTGGACGC

CCAGGGTGGAGAAGACTACGAAAACTTCCTTATGTACAGTGATGACGTCCTGCGGTCCCCAGCCAGCAGCCAGAGGCCCAGCGTTTCTGATGACACTG G

CTGCGGCTGGAAGTTCGAGCCTCTGCTCGGGGAGGAGCTGGACCTGCGGCGCGTCACGTGGCGGCTACCCCCGGAACTCATCCCGCGCCTGTCCGCCAGC

AGCGGGCGCTCTGACGAAGACGGCAGCGTTGCGGGGGGCGTGGAAGGGGAGGGCAGCGGCTGGATCCGCGGGGCTACGCCCCGACCCCCGGGAG AGCAC

CTGGTGAATGGCCGGATGGACTTTGCCTATCCAGGCAGCGCCAACTCCCTGCACAGAATGACTGCAGCCAATGTGGCCTATGGCACGCATCTGAGCCCAC

ACCTGTCCCACCGAGTGCTGAGCACGTCCTCCACCCTTACCCGGGACTACCACTCTCTGACACGCACAGAGCACTCCCACTCAGGCACACTTCCCAGGGA

CTACTCCACCCTCACTTCCCTTTCCTCCCAAG ATTCCCGTGGGGCTGTGGGTGTGCCTGACACACCCACTCGGCTGGTGTTCTCTGCCCTGGGGCCCAC

GTCTTTGAAGGTGAGCTGGCAGGAGCCACAGTGTGATCGGATGCTGCTGGGCTACAGTGTGGAATACCAGCTACTAAACGGCG GCGAGATGCATCGGCT

CAACATCCCTAACCCTGGCCAAACCTCGGTGGTGGTAGAGGATCTCCTGCCTAACCACTCCTATGTGTTCCGGGTACGGGCCCAGAGCCAGGAGGGCTGG

GGCCGAGAGCGAGAGGGTGTCATCACCATCGAGTCCCAGGTGCACCCGCAGAGCCCTCTCTGCCCCCTGCCAG GCTCAGCCTTCACTCTGAGCACCCCC

AGCGCCCCGGGACCGCTGGTGTTCACTGCCCTAAGCCCAGACTCCCTGCAGCTCAGCTGGGAGCGGCCGAGGAGGCCCAATGGAGATATCCTTGGCTACC

TGGTGACCTGTGAGATGGCCCAAGGAGGAG CACCAGCCAGGACCTTCCGGGTGGACGGAGACAACCCTGAGAGCCGGTTGACTGTACCTGGCCTCAGTG

AGAACGTTCCTTACAAGTTCAAGGTTCAGGCCAGGACGACCGAGGGCTTCGGGCCAGAGCGTGAGGGTATCATCACCATCGAGTCTCAGGTTGGAG GCC

CCTTCCCACAGCTGGGCAGCCATTCTGGGCTCTTCCAGAACCCAGTGCAAAGCGAGTTCAGCAGCGTGACCAGCACGCACAGCACCACGACTGAGCCCTT

CCTCATGG ATGGTCTAACCCTGGGGACCCAGCGCCTGGAAGCAGGAGGCTCCCTCACCCGGCATGTGACCCAGGAATTCGTGACCCGGACCTTAACGGC

CAGTGGCTCTCTCAGCACTCATATGGACCAACAGTTCTTCCAAACCTGAACCTCCCCCGCGCCCCAGCCACCTGGGCCCCTCCTTGCCTCCTCTCCTAGC

GCCTTCTTCCTCTGCTGCTCTACCCACGAGCTTGCTGACCACAGAGCCAGCCCCTGTAGTCAGAGAGCAGGGGTAGGTGCTGTCCAGGAACCATAAAGTG

GGTAGAGGTGATACAAGGTCTTTCTGACTGCATCCCACCCTGGGTCCAATCCCACATGTAACCAAAAAAAAAAAAAAAAAAACCAAAAAACAAAAAACTG

GAGCTGGCACAAGTCCCCAGCCTTTTGTTCTGCACTTAATAAAAGGTTTTGCTACTGCTT
Translation
 MAGPCCSPWVKLLLLAAMLSASLPGDLA ANRCKKAQVKSCTECIRVDKSCAYCTDE LFKERRCNTQAELLAAGCRGESILVMESSLEITE NTQIDT

SLHRSQVSPQGLQVRLRPGEERSFVFQVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLA AKILRQLTSDYTIGFGKFVDKVSVPQTDMRPEK KL

KEPWPNSDPPFSFKNVISLTENVEEFWNKLQGERISGNLDAPEGGFDAILQTAVCT RDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCH

LDASGAYTQYKTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYE KLHKYFPVSSLGVLQEDSSNIVELLEEAFY RIRSNLDIRALDSPRGLRTEVTS

DTLQKTETGSFHIKRGEV GTYNVHLRAVEDIDGTHVCQLAKEDQGGNIHLKPSFSDGLRMDASVICDVCPCEL QKEVRSARCHFRGDFMCGHCVCNEG

W WSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSGFLCND DRGRCSMGECVCEPGWTGRSCDCPLSNA

TCIDSNG GICNGRGYCECGRCHCNQQSLYTDTTCEINYSA IRLGLCEDLRSCVQCQAWGTGEKKGRACDDCPFKVKMVDELKKA - UNI34465 - 

AEEVVEYCSFRDEDDDCTYSYNVEGDGSPGPNSTVLVHKKKD DCPPGSFWWLIPLLIFLLLLLALLLLLCWKYCACCK ACLGLLPCCNRG GHMVGFK

EDHYMLRENLMASDHLDTPMLRSGNLKGRDTVRWKITNNVQRPGFATHAASTSPTELV VPYGLSLRLGRLCTENLMKPGTRECDQLRQEVEEN LNEVY

RQVSGAHKLQQTKFR RQQPNTGKK KQDHTIVDTVLLAPRSAKQMLLKLTEKQVEQGSFHELKVAPGYYTVTAEQD DARGMVEFQEGVELVDVRVPLF

IRPEDDDEKQLLVEAIDVPVGTATLGRRLVNITIIKEQA ASGVVSFEQPEYSVSRGDQVARIPVIRHILDNGKSQVSYSTQDNTAHGHR DYVPVEGEL

LFHPGETWKELQVKLLELQEVDSLLRGRQVRRFQVQLSNPKFGARLGQPSTTTVILGEHD DETDRSLINQTLSSPPPPHGDLGAPQNPNAKAAGSRKIH

FNWLPPPGKPMGYR VKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQEV VPSEPGRLAFNVVSSTVTQLSWA

EPAETNGEITAYEVCYGLVNEDNR RPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSI IPIIPDIPIVDA

QGGEDYENFLMYSDDVLRSPASSQRPSVSDDTG GCGWKFEPLLGEELDLRRVTWRLPPELIPRLSASSGRSDEDGSVAGGVEGEGSGWIRGATPRPPGE

 EHLVNGRMDFAYPGSANSLHRMTAANVAYGTHLSPHLSHRVLSTSSTLTRDYHSLTRTEHSHSGTLPRDYSTLTSLSSQD DSRGAVGVPDTPTRLVFS

ALGPTSLKVSWQEPQCDRMLLGYSVEYQLLNGG GEMHRLNIPNPGQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPG G

SAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGA APARTFRVDGDNPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGI

ITIESQVGG GPFPQLGSHSGLFQNPVQSEFSSVTSTHSTTTEPFLMD DGLTLGTQRLEAGGSLTRHVTQEFVTRTLTASGSLSTHMDQQFFQT
Transcript ENSMUST00000106460
Sequence
GGACTGACCCAGCTGGGCTCACTGTATTAAGAAGCGGACCCGCGACCCGGAGCGGCCCGGGGACCCGATCTGGGAGCCTGGACGGGTGGGGAAGACGGAG

CCCCGGTCTGTGCTGCAGGGAAGAGTGGCTCCTCCTCCAGCCCCCTCCGCGGCGGCTCGGGGCTCGGGGCCGGCGCCGGTTGAGCCGCAGCCCTTTCCGG

GGGGCGGGCCTGGCGGCTGCGGCGACACCCCAGCTCCTGCCCCGACAGGTGCGCGCAGCGCGCAGGAATGCAGTCCGCCTGACTCACCAGCGCCTCCTTC

CTACCTGCGCCGCCCGTCCATAAAGCGCTGCTGGCTCCCGCCCGCCGCCGCCCGCCCTGCTGTCCCGCCGGGCTCGCCCGCGCGCTCAGCTCGACCCAAC

GCAGCCCAAGTCCGAGGTAGTCTCACTAAG GAGGAGGAGGATGGCAGGGCCCTGTTGCAGCCCATGGGTGAAGCTGCTGCTGCTGGCAGCAATGCTGAG

TGCCAGCCTCCCTGGAGACCTGG CCAACCGCTGCAAGAAGGCTCAGGTGAAGAGCTGTACCGAGTGCATCCGGGTGGACAAGAGCTGTGCCTACTGCAC

AGACGAG CTGTTCAAGGAGAGGCGCTGCAACACCCAGGCGGAGCTTCTGGCTGCAGGCTGCAGGGGAGAGAGCATCCTGGTCATGGAGAGCAGCCTTGA

AATCACAGAG AACACCCAGATCGACACCAGCCTGCACCGCAGCCAGGTATCTCCCCAAGGCCTGCAAGTCCGGCTGCGGCCGGGTGAGGAGCGCAGCTT

TGTGTTCCAGGTGTTTGAGCCCCTGGAGAGCCCCGTGGATCTGTATATCCTCATGGACTTCTCCAACTCCATGTCTGACGATCTGGACAACCTCAAGCAG

ATGGGGCAGAACCTGG CCAAGATCCTGCGCCAGCTCACCAGCGACTACACCATTGGATTTGGAAAGTTTGTGGACAAAGTCAGCGTCCCACAGACAGAC

ATGAGGCCCGAGAA ACTGAAGGAGCCCTGGCCCAACAGTGATCCCCCGTTCTCCTTCAAGAACGTTATCAGCTTAACGGAGAATGTGGAAGAATTCTGG

AACAAACTGCAAGGAGAACGCATCTCAGGCAACCTGGACGCTCCTGAAGGGGGCTTTGATGCCATCCTGCAGACAGCTGTGTGCACA AGGGACATTGGC

TGGAGGGCTGACAGCACCCACCTGCTGGTGTTCTCCACCGAGTCTGCCTTCCACTACGAGGCTGATGGTGCCAACGTGCTGGCCGGCATCATGAACCGCA

ATGATGAGAAATGCCACCTGGACGCCTCGGGCGCCTACACCCAATACAAGACACAGGACTACCCATCAGTGCCCACGCTGGTTCGCCTGCTTGCCAAGCA

TAACATCATCCCCATCTTTGCTGTCACCAACTACTCTTACAGCTACTATGAG AAGCTCCATAAGTATTTCCCCGTCTCCTCTCTGGGCGTCCTGCAGGA

GGATTCATCCAACATCGTGGAGCTGCTGGAGGAGGCCTTCTAT CGAATTCGCTCCAACCTGGACATCCGGGCTCTGGACAGCCCCAGAGGCCTGAGAAC

AGAGGTCACCTCCGATACTCTCCAGAAGACGGAGACTGGGTCCTTTCACATCAAGCGGGGGGAAGTG GGCACATACAATGTGCATCTCCGGGCAGTGGA

GGACATAGATGGGACACATGTGTGCCAGCTGGCTAAAGAAGACCAAGGGGGCAACATCCACCTGAAACCCTCCTTCTCTGATGGCCTCCGGATGGACGCG

AGTGTGATCTGTGACGTGTGCCCCTGTGAGCTG CAAAAGGAAGTTCGATCAGCTCGCTGTCACTTCAGAGGAGACTTCATGTGTGGACACTGTGTGTGC

AATGAGGGCTG GAGTGGCAAAACCTGCAACTGCTCCACCGGCTCTCTGAGTGACACACAGCCCTGCCTGCGTGAGGGTGAGGACAAACCGTGCTCGGGC

CACGGCGAGTGCCAGTGCGGACGCTGTGTGTGCTATGGTGAAGGCCGCTACGAGGGTCACTTCTGCGAGTATGACAACTTCCAGTGTCCCCGGACCTCTG

GATTCCTGTGCAATG ACCGGGGTCGCTGTTCTATGGGAGAGTGTGTGTGTGAGCCTGGTTGGACAGGCCGCAGCTGTGACTGTCCCCTCAGCAATGCCA

CCTGCATCGATAGCAACGGG GGCATCTGCAACGGCCGAGGCTACTGTGAGTGTGGCCGTTGTCACTGCAACCAGCAGTCGCTCTACACGGACACCACCT

GTGAGATCAACTACTCTGCG ATACGCCTGGGTCTCTGTGAGGATCTCCGCTCCTGCGTACAGTGCCAGGCCTGGGGCACCGGGGAGAAGAAAGGGCGCG

CGTGTGACGATTGCCCCTTTAAAGTCAAGATGGTAGACGAGCTTAAGAAAG - UNI34465 - CAGAAGAGGTGGTGGAGTACTGCTCCTTCCGGGAT

GAGGATGACGACTGCACTTACAGCTACAACGTGGAGGGCGATGGCAGCCCTGGGCCCAACAGCACAGTCCTGGTCCACAAAAAGAAAG ACTGCCCTCCC

GGCTCCTTCTGGTGGCTCATCCCCCTGCTCATCTTCCTCCTGTTGCTCCTGGCGTTGCTTCTGCTGCTCTGCTGGAAATACTGTGCCTGCTGCAAA GCC

TGCCTGGGGCTTCTTCCTTGCTGCAACCGAG GTCACATGGTGGGCTTTAAGGAAGATCACTATATGCTTCGGGAGAACCTGATGGCCTCTGACCACCTG

GACACGCCCATGCTACGAAGCGGGAACCTCAAGGGACGAGACACAGTCCGCTGGAAGATCACCAACAATGTGCAGCGCCCTGGCTTTGCCACCCATGCCG

CCAGCACCAGCCCCACGGAGCTCG TACCCTACGGGCTGTCCCTGCGCCTTGGCCGCCTCTGCACTGAGAACCTTATGAAGCCGGGCACCCGAGAGTGTG

ACCAGCTACGCCAGGAGGTGGAGGAAAAT CTGAATGAGGTGTATAGACAGGTCAGCGGCGCACACAAGCTCCAGCAGACGAAGTTCCG ACAGCAGCCC

AACACCGGGAAAAA GCAAGACCACACCATTGTGGACACAGTGTTGCTGGCGCCCCGCTCCGCCAAGCAGATGCTGCTGAAGCTGACAGAGAAGCAGGTG

GAGCAGGGGTCCTTCCATGAACTGAAGGTGGCCCCTGGCTACTACACTGTCACGGCAGAGCAGG ATGCCCGGGGCATGGTGGAGTTCCAGGAGGGCGTG

GAGCTGGTGGATGTGCGAGTGCCCCTCTTCATCCGGCCTGAGGATGATGATGAGAAGCAGCTGCTGGTGGAGGCCATTGATGTCCCTGTGGGCACTGCCA

CCCTTGGTCGCCGTCTGGTAAACATCACCATTATCAAGGAACAAG CTAGTGGGGTAGTGTCCTTCGAGCAGCCTGAATACTCGGTGAGTCGTGGAGACC

AGGTGGCCCGCATCCCTGTCATCCGGCACATCCTGGACAATGGCAAGTCCCAGGTCTCCTATAGCACACAGGATAATACAGCACACGGACACCGG GATT

ATGTCCCTGTGGAGGGAGAGCTGCTGTTCCATCCTGGGGAGACCTGGAAGGAGTTGCAGGTGAAGCTACTGGAGCTGCAGGAGGTCGACTCCCTCCTGCG

TGGCCGCCAGGTCCGCCGCTTCCAAGTCCAACTCAGCAACCCCAAGTTCGGAGCCCGCCTGGGCCAGCCCAGCACAACCACCGTTATTCTCGGTGAGCAC

G ATGAAACGGACAGGAGTCTCATAAATCAAACACTTTCATCGCCTCCGCCACCCCATGGAGACCTGGGCGCCCCACAGAACCCCAATGCCAAGGCTGCC

GGGTCCAGGAAGATCCATTTCAACTGGCTGCCCCCTCCTGGCAAGCCAATGGGGTACAGG GTGAAGTACTGGATCCAGGGCGACTCTGAGTCTGAAGCC

CACCTTCTAGACAGCAAGGTGCCCTCAGTGGAACTCACCAACCTGTATCCCTATTGCGACTACGAAATGAAGGTGTGTGCCTATGGGGCACAGGGTGAGG

GGCCCTATAGCTCACTGGTGTCCTGCCGCACCCACCAGGAAG TACCCAGCGAGCCAGGGAGGCTGGCTTTCAATGTAGTCTCTTCTACGGTGACGCAGC

TGAGCTGGGCAGAGCCAGCTGAGACCAATGGCGAGATCACAGCCTACGAGGTCTGCTATGGACTGGTCAATGAGGACAACC GACCCATTGGACCTATGA

AGAAGGTGCTCGTGGACAACCCCAAGAACCGGATGCTGCTCATTGAGAATCTGCGAGAATCCCAGCCATACCGATACACGGTTAAGGCGCGCAATGGGGC

AGGATGGGGACCCGAGAGAGAGGCTATCATCAACCTGGCTACACAGCCCAAGCGGCCCATGTCCA TCCCTATCATCCCAGACATCCCCATAGTGGACGC

CCAGGGTGGAGAAGACTACGAAAACTTCCTTATGTACAGTGATGACGTCCTGCGGTCCCCAGCCAGCAGCCAGAGGCCCAGCGTTTCTGATGACACTG A

GCACCTGGTGAATGGCCGGATGGACTTTGCCTATCCAGGCAGCGCCAACTCCCTGCACAGAATGACTGCAGCCAATGTGGCCTATGGCACGCATCTGAGC

CCACACCTGTCCCACCGAGTGCTGAGCACGTCCTCCACCCTTACCCGGGACTACCACTCTCTGACACGCACAGAGCACTCCCACTCAGGCACACTTCCCA

GGGACTACTCCACCCTCACTTCCCTTTCCTCCCAAG GCCTCCCTCCTATCTGGGAAGATGGGAGGAGCAGGCTTCCGCTGTCCTGGACTCTTGGGTCCT

TGAGCCGGGCTCACATGAAGGGTGTGCCCGCATCCAGGGGTTCACCAGACTCTATAATCCTGGCCGGGCAGTCAGCAGCACCCTCCTGGGGTACAG ATT

CCCGTGGGGCTGTGGGTGTGCCTGACACACCCACTCGGCTGGTGTTCTCTGCCCTGGGGCCCACGTCTTTGAAGGTGAGCTGGCAGGAGCCACAGTGTGA

TCGGATGCTGCTGGGCTACAGTGTGGAATACCAGCTACTAAACGGCG GCGAGATGCATCGGCTCAACATCCCTAACCCTGGCCAAACCTCGGTGGTGGT

AGAGGATCTCCTGCCTAACCACTCCTATGTGTTCCGGGTACGGGCCCAGAGCCAGGAGGGCTGGGGCCGAGAGCGAGAGGGTGTCATCACCATCGAGTCC

CAGGTGCACCCGCAGAGCCCTCTCTGCCCCCTGCCAG GCTCAGCCTTCACTCTGAGCACCCCCAGCGCCCCGGGACCGCTGGTGTTCACTGCCCTAAGC

CCAGACTCCCTGCAGCTCAGCTGGGAGCGGCCGAGGAGGCCCAATGGAGATATCCTTGGCTACCTGGTGACCTGTGAGATGGCCCAAGGAGGAG CACCA

GCCAGGACCTTCCGGGTGGACGGAGACAACCCTGAGAGCCGGTTGACTGTACCTGGCCTCAGTGAGAACGTTCCTTACAAGTTCAAGGTTCAGGCCAGGA

CGACCGAGGGCTTCGGGCCAGAGCGTGAGGGTATCATCACCATCGAGTCTCAGGTTGGAG GCCCCTTCCCACAGCTGGGCAGCCATTCTGGGCTCTTCC

AGAACCCAGTGCAAAGCGAGTTCAGCAGCGTGACCAGCACGCACAGCACCACGACTGAGCCCTTCCTCATGG ATGGTCTAACCCTGGGGACCCAGCGCC

TGGAAGCAGGAGGCTCCCTCACCCGGCATGTGACCCAGGAATTCGTGACCCGGACCTTAACGGCCAGTGGCTCTCTCAGCACTCATATGGACCAACAGTT

CTTCCAAACCTGAACCTCCCCCGCGCCCCAGCCACCTGGGCCCCTCCTTGCCTCCTCTCCTAGCGCCTTCTTCCTCTGCTGCTCTACCCACGAGCTTGCT

GACCACAGAGCCAGCCCCTGTAGTCAGAGAGCAGGGGTAGGTGCTGTCCAGGAACCATAAAGTGGGTAGAGGTGATACAAGGTCTTTCTGACTGCATCCC

ACCCTGGGTCCAATCCCACATGTAACCAAAAAAAAAAAAAAAAAAACCAAAAAACAAAAAACTGGAGCTGGCACAAGTCCCCAGCCTTTTGTTCTGCACT

TAATAAAAGGTTTTGCTACTGCTT
Translation
 MAGPCCSPWVKLLLLAAMLSASLPGDLA ANRCKKAQVKSCTECIRVDKSCAYCTDE LFKERRCNTQAELLAAGCRGESILVMESSLEITE NTQIDT

SLHRSQVSPQGLQVRLRPGEERSFVFQVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLA AKILRQLTSDYTIGFGKFVDKVSVPQTDMRPEK KL

KEPWPNSDPPFSFKNVISLTENVEEFWNKLQGERISGNLDAPEGGFDAILQTAVCT RDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCH

LDASGAYTQYKTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYE KLHKYFPVSSLGVLQEDSSNIVELLEEAFY RIRSNLDIRALDSPRGLRTEVTS

DTLQKTETGSFHIKRGEV GTYNVHLRAVEDIDGTHVCQLAKEDQGGNIHLKPSFSDGLRMDASVICDVCPCEL QKEVRSARCHFRGDFMCGHCVCNEG

W WSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSGFLCND DRGRCSMGECVCEPGWTGRSCDCPLSNA

TCIDSNG GICNGRGYCECGRCHCNQQSLYTDTTCEINYSA IRLGLCEDLRSCVQCQAWGTGEKKGRACDDCPFKVKMVDELKKA - UNI34465 - 

AEEVVEYCSFRDEDDDCTYSYNVEGDGSPGPNSTVLVHKKKD DCPPGSFWWLIPLLIFLLLLLALLLLLCWKYCACCK ACLGLLPCCNRG GHMVGFK

EDHYMLRENLMASDHLDTPMLRSGNLKGRDTVRWKITNNVQRPGFATHAASTSPTELV VPYGLSLRLGRLCTENLMKPGTRECDQLRQEVEEN LNEVY

RQVSGAHKLQQTKFR RQQPNTGKK KQDHTIVDTVLLAPRSAKQMLLKLTEKQVEQGSFHELKVAPGYYTVTAEQD DARGMVEFQEGVELVDVRVPLF

IRPEDDDEKQLLVEAIDVPVGTATLGRRLVNITIIKEQA ASGVVSFEQPEYSVSRGDQVARIPVIRHILDNGKSQVSYSTQDNTAHGHR DYVPVEGEL

LFHPGETWKELQVKLLELQEVDSLLRGRQVRRFQVQLSNPKFGARLGQPSTTTVILGEHD DETDRSLINQTLSSPPPPHGDLGAPQNPNAKAAGSRKIH

FNWLPPPGKPMGYR VKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQEV VPSEPGRLAFNVVSSTVTQLSWA

EPAETNGEITAYEVCYGLVNEDNR RPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSI IPIIPDIPIVDA

QGGEDYENFLMYSDDVLRSPASSQRPSVSDDTE EHLVNGRMDFAYPGSANSLHRMTAANVAYGTHLSPHLSHRVLSTSSTLTRDYHSLTRTEHSHSGTL

PRDYSTLTSLSSQG GLPPIWEDGRSRLPLSWTLGSLSRAHMKGVPASRGSPDSIILAGQSAAPSWGTD DSRGAVGVPDTPTRLVFSALGPTSLKVSWQ

EPQCDRMLLGYSVEYQLLNGG GEMHRLNIPNPGQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPG GSAFTLSTPSAPG

PLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGA APARTFRVDGDNPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQVGG GP

FPQLGSHSGLFQNPVQSEFSSVTSTHSTTTEPFLMD DGLTLGTQRLEAGGSLTRHVTQEFVTRTLTASGSLSTHMDQQFFQT
Transcript ENSMUST00000021107
Sequence
GACCGTCGAGGCAGCGGGACTGACCCAGCTGGGCTCACTGTATTAAGAAGCGGACCCGCGACCCGGAGCGGCCCGGGGACCCGATCTGGGAGCCTGGACG

G GTGCGCGCAGCGCGCAGGAATGCAGTCCGCCTGACTCACCAGCGCCTCCTTCCTACCTGCGCCGCCCGTCCATAAAGCGCTGCTGGCTCCCGCCCGCC

GCCGCCCGCCCTGCTGTCCCGCCGGGCTCGCCCGCGCGCTCAGCTCGACCCAACGCAGCCCAAGTCCGAGGTAGTCTCACTAAG GAGGAGGAGGATGGC

AGGGCCCTGTTGCAGCCCATGGGTGAAGCTGCTGCTGCTGGCAGCAATGCTGAGTGCCAGCCTCCCTGGAGACCTGG CCAACCGCTGCAAGAAGGCTCA

GGTGAAGAGCTGTACCGAGTGCATCCGGGTGGACAAGAGCTGTGCCTACTGCACAGACGAG CTGTTCAAGGAGAGGCGCTGCAACACCCAGGCGGAGCT

TCTGGCTGCAGGCTGCAGGGGAGAGAGCATCCTGGTCATGGAGAGCAGCCTTGAAATCACAGAG AACACCCAGATCGACACCAGCCTGCACCGCAGCCA

GGTATCTCCCCAAGGCCTGCAAGTCCGGCTGCGGCCGGGTGAGGAGCGCAGCTTTGTGTTCCAGGTGTTTGAGCCCCTGGAGAGCCCCGTGGATCTGTAT

ATCCTCATGGACTTCTCCAACTCCATGTCTGACGATCTGGACAACCTCAAGCAGATGGGGCAGAACCTGG CCAAGATCCTGCGCCAGCTCACCAGCGAC

TACACCATTGGATTTGGAAAGTTTGTGGACAAAGTCAGCGTCCCACAGACAGACATGAGGCCCGAGAA ACTGAAGGAGCCCTGGCCCAACAGTGATCCC

CCGTTCTCCTTCAAGAACGTTATCAGCTTAACGGAGAATGTGGAAGAATTCTGGAACAAACTGCAAGGAGAACGCATCTCAGGCAACCTGGACGCTCCTG

AAGGGGGCTTTGATGCCATCCTGCAGACAGCTGTGTGCACA AGGGACATTGGCTGGAGGGCTGACAGCACCCACCTGCTGGTGTTCTCCACCGAGTCTG

CCTTCCACTACGAGGCTGATGGTGCCAACGTGCTGGCCGGCATCATGAACCGCAATGATGAGAAATGCCACCTGGACGCCTCGGGCGCCTACACCCAATA

CAAGACACAGGACTACCCATCAGTGCCCACGCTGGTTCGCCTGCTTGCCAAGCATAACATCATCCCCATCTTTGCTGTCACCAACTACTCTTACAGCTAC

TATGAG AAGCTCCATAAGTATTTCCCCGTCTCCTCTCTGGGCGTCCTGCAGGAGGATTCATCCAACATCGTGGAGCTGCTGGAGGAGGCCTTCTAT CG

AATTCGCTCCAACCTGGACATCCGGGCTCTGGACAGCCCCAGAGGCCTGAGAACAGAGGTCACCTCCGATACTCTCCAGAAGACGGAGACTGGGTCCTTT

CACATCAAGCGGGGGGAAGTG GGCACATACAATGTGCATCTCCGGGCAGTGGAGGACATAGATGGGACACATGTGTGCCAGCTGGCTAAAGAAGACCAA

GGGGGCAACATCCACCTGAAACCCTCCTTCTCTGATGGCCTCCGGATGGACGCGAGTGTGATCTGTGACGTGTGCCCCTGTGAGCTG CAAAAGGAAGTT

CGATCAGCTCGCTGTCACTTCAGAGGAGACTTCATGTGTGGACACTGTGTGTGCAATGAGGGCTG GAGTGGCAAAACCTGCAACTGCTCCACCGGCTCT

CTGAGTGACACACAGCCCTGCCTGCGTGAGGGTGAGGACAAACCGTGCTCGGGCCACGGCGAGTGCCAGTGCGGACGCTGTGTGTGCTATGGTGAAGGCC

GCTACGAGGGTCACTTCTGCGAGTATGACAACTTCCAGTGTCCCCGGACCTCTGGATTCCTGTGCAATG ACCGGGGTCGCTGTTCTATGGGAGAGTGTG

TGTGTGAGCCTGGTTGGACAGGCCGCAGCTGTGACTGTCCCCTCAGCAATGCCACCTGCATCGATAGCAACGGG GGCATCTGCAACGGCCGAGGCTACT

GTGAGTGTGGCCGTTGTCACTGCAACCAGCAGTCGCTCTACACGGACACCACCTGTGAGATCAACTACTCTGCG ATACGCCTGGGTCTCTGTGAGGATC

TCCGCTCCTGCGTACAGTGCCAGGCCTGGGGCACCGGGGAGAAGAAAGGGCGCGCGTGTGACGATTGCCCCTTTAAAGTCAAGATGGTAGACGAGCTTAA

GAAAG - UNI34465 - AAGAGGTGGTGGAGTACTGCTCCTTCCGGGATGAGGATGACGACTGCACTTACAGCTACAACGTGGAGGGCGATGGCAGCC

CTGGGCCCAACAGCACAGTCCTGGTCCACAAAAAGAAAG ACTGCCCTCCCGGCTCCTTCTGGTGGCTCATCCCCCTGCTCATCTTCCTCCTGTTGCTCC

TGGCGTTGCTTCTGCTGCTCTGCTGGAAATACTGTGCCTGCTGCAAA GCCTGCCTGGGGCTTCTTCCTTGCTGCAACCGAG GTCACATGGTGGGCTTT

AAGGAAGATCACTATATGCTTCGGGAGAACCTGATGGCCTCTGACCACCTGGACACGCCCATGCTACGAAGCGGGAACCTCAAGGGACGAGACACAGTCC

GCTGGAAGATCACCAACAATGTGCAGCGCCCTGGCTTTGCCACCCATGCCGCCAGCACCAGCCCCACGGAGCTCG TACCCTACGGGCTGTCCCTGCGCC

TTGGCCGCCTCTGCACTGAGAACCTTATGAAGCCGGGCACCCGAGAGTGTGACCAGCTACGCCAGGAGGTGGAGGAAAAT CTGAATGAGGTGTATAGAC

AGGTCAGCGGCGCACACAAGCTCCAGCAGACGAAGTTCCG ACAGCAGCCCAACACCGGGAAAAA GCAAGACCACACCATTGTGGACACAGTGTTGCTG

GCGCCCCGCTCCGCCAAGCAGATGCTGCTGAAGCTGACAGAGAAGCAGGTGGAGCAGGGGTCCTTCCATGAACTGAAGGTGGCCCCTGGCTACTACACTG

TCACGGCAGAGCAGG ATGCCCGGGGCATGGTGGAGTTCCAGGAGGGCGTGGAGCTGGTGGATGTGCGAGTGCCCCTCTTCATCCGGCCTGAGGATGATG

ATGAGAAGCAGCTGCTGGTGGAGGCCATTGATGTCCCTGTGGGCACTGCCACCCTTGGTCGCCGTCTGGTAAACATCACCATTATCAAGGAACAAG CTA

GTGGGGTAGTGTCCTTCGAGCAGCCTGAATACTCGGTGAGTCGTGGAGACCAGGTGGCCCGCATCCCTGTCATCCGGCACATCCTGGACAATGGCAAGTC

CCAGGTCTCCTATAGCACACAGGATAATACAGCACACGGACACCGG GATTATGTCCCTGTGGAGGGAGAGCTGCTGTTCCATCCTGGGGAGACCTGGAA

GGAGTTGCAGGTGAAGCTACTGGAGCTGCAGGAGGTCGACTCCCTCCTGCGTGGCCGCCAGGTCCGCCGCTTCCAAGTCCAACTCAGCAACCCCAAGTTC

GGAGCCCGCCTGGGCCAGCCCAGCACAACCACCGTTATTCTCG ATGAAACGGACAGGAGTCTCATAAATCAAACACTTTCATCGCCTCCGCCACCCCAT

GGAGACCTGGGCGCCCCACAGAACCCCAATGCCAAGGCTGCCGGGTCCAGGAAGATCCATTTCAACTGGCTGCCCCCTCCTGGCAAGCCAATGGGGTACA

GG GTGAAGTACTGGATCCAGGGCGACTCTGAGTCTGAAGCCCACCTTCTAGACAGCAAGGTGCCCTCAGTGGAACTCACCAACCTGTATCCCTATTGCG

ACTACGAAATGAAGGTGTGTGCCTATGGGGCACAGGGTGAGGGGCCCTATAGCTCACTGGTGTCCTGCCGCACCCACCAGGAAG TACCCAGCGAGCCAG

GGAGGCTGGCTTTCAATGTAGTCTCTTCTACGGTGACGCAGCTGAGCTGGGCAGAGCCAGCTGAGACCAATGGCGAGATCACAGCCTACGAGGTCTGCTA

TGGACTGGTCAATGAGGACAACC GACCCATTGGACCTATGAAGAAGGTGCTCGTGGACAACCCCAAGAACCGGATGCTGCTCATTGAGAATCTGCGAGA

ATCCCAGCCATACCGATACACGGTTAAGGCGCGCAATGGGGCAGGATGGGGACCCGAGAGAGAGGCTATCATCAACCTGGCTACACAGCCCAAGCGGCCC

ATGTCCA TCCCTATCATCCCAGACATCCCCATAGTGGACGCCCAGGGTGGAGAAGACTACGAAAACTTCCTTATGTACAGTGATGACGTCCTGCGGTCC

CCAGCCAGCAGCCAGAGGCCCAGCGTTTCTGATGACACTG AGCACCTGGTGAATGGCCGGATGGACTTTGCCTATCCAGGCAGCGCCAACTCCCTGCAC

AGAATGACTGCAGCCAATGTGGCCTATGGCACGCATCTGAGCCCACACCTGTCCCACCGAGTGCTGAGCACGTCCTCCACCCTTACCCGGGACTACCACT

CTCTGACACGCACAGAGCACTCCCACTCAGGCACACTTCCCAGGGACTACTCCACCCTCACTTCCCTTTCCTCCCAAG GCCTCCCTCCTATCTGGGAAG

ATGGGAGGAGCAGGCTTCCGCTGTCCTGGACTCTTGGGTCCTTGAGCCGGGCTCACATGAAGGGTGTGCCCGCATCCAGGGGTTCACCAGACTCTATAAT

CCTGGCCGGGCAGTCAGCAGCACCCTCCTGGGGTACAG ATTCCCGTGGGGCTGTGGGTGTGCCTGACACACCCACTCGGCTGGTGTTCTCTGCCCTGGG

GCCCACGTCTTTGAAGGTGAGCTGGCAGGAGCCACAGTGTGATCGGATGCTGCTGGGCTACAGTGTGGAATACCAGCTACTAAACGGCG GCGAGATGCA

TCGGCTCAACATCCCTAACCCTGGCCAAACCTCGGTGGTGGTAGAGGATCTCCTGCCTAACCACTCCTATGTGTTCCGGGTACGGGCCCAGAGCCAGGAG

GGCTGGGGCCGAGAGCGAGAGGGTGTCATCACCATCGAGTCCCAGGTGCACCCGCAGAGCCCTCTCTGCCCCCTGCCAG GCTCAGCCTTCACTCTGAGC

ACCCCCAGCGCCCCGGGACCGCTGGTGTTCACTGCCCTAAGCCCAGACTCCCTGCAGCTCAGCTGGGAGCGGCCGAGGAGGCCCAATGGAGATATCCTTG

GCTACCTGGTGACCTGTGAGATGGCCCAAGGAGGAG CACCAGCCAGGACCTTCCGGGTGGACGGAGACAACCCTGAGAGCCGGTTGACTGTACCTGGCC

TCAGTGAGAACGTTCCTTACAAGTTCAAGGTTCAGGCCAGGACGACCGAGGGCTTCGGGCCAGAGCGTGAGGGTATCATCACCATCGAGTCTCAGGTTGG

AG GCCCCTTCCCACAGCTGGGCAGCCATTCTGGGCTCTTCCAGAACCCAGTGCAAAGCGAGTTCAGCAGCGTGACCAGCACGCACAGCACCACGACTGA

GCCCTTCCTCATGG ATGGTCTAACCCTGGGGACCCAGCGCCTGGAAGCAGGAGGCTCCCTCACCCGGCATGTGACCCAGGAATTCGTGACCCGGACCTT

AACGGCCAGTGGCTCTCTCAGCACTCATATGGACCAACAGTTCTTCCAAACCTGAACCTCCCCCGCGCCCCAGCCACCTGGGCCCCTCCTTGCCTCCTCT

CCTAGCGCCTTCTTCCTCTGCTGCTCTACCCACGAGCTTGCTGACCACAGAGCCAGCCCCTGTAGTCAGAGAGCAGGGGTAGGTGCTGTCCAGGAACCAT

AAAGTGGGTAGAGGTGATACAAGGTCTTTCTGACTGCATCCCACCCTGGGTCCAATCCCACATGTAACCAAAAAAAAAAAAAAAAAAACCAAAAAACAAA

AAACTGGAGCTGGCACAAGTCCCCAGCCTTTTGTTCTGCACTTAATAAAAGGTTTTGCTACTGCTTA
Translation
  MAGPCCSPWVKLLLLAAMLSASLPGDLA ANRCKKAQVKSCTECIRVDKSCAYCTDE LFKERRCNTQAELLAAGCRGESILVMESSLEITE NTQID

TSLHRSQVSPQGLQVRLRPGEERSFVFQVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLA AKILRQLTSDYTIGFGKFVDKVSVPQTDMRPEK K

LKEPWPNSDPPFSFKNVISLTENVEEFWNKLQGERISGNLDAPEGGFDAILQTAVCT RDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKC

HLDASGAYTQYKTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYE KLHKYFPVSSLGVLQEDSSNIVELLEEAFY RIRSNLDIRALDSPRGLRTEVT

SDTLQKTETGSFHIKRGEV GTYNVHLRAVEDIDGTHVCQLAKEDQGGNIHLKPSFSDGLRMDASVICDVCPCEL QKEVRSARCHFRGDFMCGHCVCNE

GW WSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSGFLCND DRGRCSMGECVCEPGWTGRSCDCPLSN

ATCIDSNG GICNGRGYCECGRCHCNQQSLYTDTTCEINYSA IRLGLCEDLRSCVQCQAWGTGEKKGRACDDCPFKVKMVDELKKE - UNI34465 -

 EEVVEYCSFRDEDDDCTYSYNVEGDGSPGPNSTVLVHKKKD DCPPGSFWWLIPLLIFLLLLLALLLLLCWKYCACCK ACLGLLPCCNRG GHMVGFK

EDHYMLRENLMASDHLDTPMLRSGNLKGRDTVRWKITNNVQRPGFATHAASTSPTELV VPYGLSLRLGRLCTENLMKPGTRECDQLRQEVEEN LNEVY

RQVSGAHKLQQTKFR RQQPNTGKK KQDHTIVDTVLLAPRSAKQMLLKLTEKQVEQGSFHELKVAPGYYTVTAEQD DARGMVEFQEGVELVDVRVPLF

IRPEDDDEKQLLVEAIDVPVGTATLGRRLVNITIIKEQA ASGVVSFEQPEYSVSRGDQVARIPVIRHILDNGKSQVSYSTQDNTAHGHR DYVPVEGEL

LFHPGETWKELQVKLLELQEVDSLLRGRQVRRFQVQLSNPKFGARLGQPSTTTVILD DETDRSLINQTLSSPPPPHGDLGAPQNPNAKAAGSRKIHFNW

LPPPGKPMGYR VKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQEV VPSEPGRLAFNVVSSTVTQLSWAEPA

ETNGEITAYEVCYGLVNEDNR RPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSI IPIIPDIPIVDAQGG

EDYENFLMYSDDVLRSPASSQRPSVSDDTE EHLVNGRMDFAYPGSANSLHRMTAANVAYGTHLSPHLSHRVLSTSSTLTRDYHSLTRTEHSHSGTLPRD

YSTLTSLSSQG GLPPIWEDGRSRLPLSWTLGSLSRAHMKGVPASRGSPDSIILAGQSAAPSWGTD DSRGAVGVPDTPTRLVFSALGPTSLKVSWQEPQ

CDRMLLGYSVEYQLLNGG GEMHRLNIPNPGQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPG GSAFTLSTPSAPGPLV

FTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGA APARTFRVDGDNPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQVGG GPFPQ

LGSHSGLFQNPVQSEFSSVTSTHSTTTEPFLMD DGLTLGTQRLEAGGSLTRHVTQEFVTRTLTASGSLSTHMDQQFFQT
Transcript ENSMUST00000068981
Sequence
GAGGAGGAGGATGGCAGGGCCCTGTTGCAGCCCATGGGTGAAGCTGCTGCTGCTGGCAGCAATGCTGAGTGCCAGCCTCCCTGGAGACCTGG CCAACCG

CTGCAAGAAGGCTCAGGTGAAGAGCTGTACCGAGTGCATCCGGGTGGACAAGAGCTGTGCCTACTGCACAGACGAG CTGTTCAAGGAGAGGCGCTGCAA

CACCCAGGCGGAGCTTCTGGCTGCAGGCTGCAGGGGAGAGAGCATCCTGGTCATGGAGAGCAGCCTTGAAATCACAGAG AACACCCAGATCGACACCAG

CCTGCACCGCAGCCAGGTATCTCCCCAAGGCCTGCAAGTCCGGCTGCGGCCGGGTGAGGAGCGCAGCTTTGTGTTCCAGGTGTTTGAGCCCCTGGAGAGC

CCCGTGGATCTGTATATCCTCATGGACTTCTCCAACTCCATGTCTGACGATCTGGACAACCTCAAGCAGATGGGGCAGAACCTGG CCAAGATCCTGCGC

CAGCTCACCAGCGACTACACCATTGGATTTGGAAAGTTTGTGGACAAAGTCAGCGTCCCACAGACAGACATGAGGCCCGAGAA ACTGAAGGAGCCCTGG

CCCAACAGTGATCCCCCGTTCTCCTTCAAGAACGTTATCAGCTTAACGGAGAATGTGGAAGAATTCTGGAACAAACTGCAAGGAGAACGCATCTCAGGCA

ACCTGGACGCTCCTGAAGGGGGCTTTGATGCCATCCTGCAGACAGCTGTGTGCACA AGGGACATTGGCTGGAGGGCTGACAGCACCCACCTGCTGGTGT

TCTCCACCGAGTCTGCCTTCCACTACGAGGCTGATGGTGCCAACGTGCTGGCCGGCATCATGAACCGCAATGATGAGAAATGCCACCTGGACGCCTCGGG

CGCCTACACCCAATACAAGACACAGGACTACCCATCAGTGCCCACGCTGGTTCGCCTGCTTGCCAAGCATAACATCATCCCCATCTTTGCTGTCACCAAC

TACTCTTACAGCTACTATGAG AAGCTCCATAAGTATTTCCCCGTCTCCTCTCTGGGCGTCCTGCAGGAGGATTCATCCAACATCGTGGAGCTGCTGGAG

GAGGCCTTCTAT CGAATTCGCTCCAACCTGGACATCCGGGCTCTGGACAGCCCCAGAGGCCTGAGAACAGAGGTCACCTCCGATACTCTCCAGAAGACG

GAGACTGGGTCCTTTCACATCAAGCGGGGGGAAGTG GGCACATACAATGTGCATCTCCGGGCAGTGGAGGACATAGATGGGACACATGTGTGCCAGCTG

GCTAAAGAAGACCAAGGGGGCAACATCCACCTGAAACCCTCCTTCTCTGATGGCCTCCGGATGGACGCGAGTGTGATCTGTGACGTGTGCCCCTGTGAGC

TG CAAAAGGAAGTTCGATCAGCTCGCTGTCACTTCAGAGGAGACTTCATGTGTGGACACTGTGTGTGCAATGAGGGCTG GAGTGGCAAAACCTGCAAC

TGCTCCACCGGCTCTCTGAGTGACACACAGCCCTGCCTGCGTGAGGGTGAGGACAAACCGTGCTCGGGCCACGGCGAGTGCCAGTGCGGACGCTGTGTGT

GCTATGGTGAAGGCCGCTACGAGGGTCACTTCTGCGAGTATGACAACTTCCAGTGTCCCCGGACCTCTGGATTCCTGTGCAATG ACCGGGGTCGCTGTT

CTATGGGAGAGTGTGTGTGTGAGCCTGGTTGGACAGGCCGCAGCTGTGACTGTCCCCTCAGCAATGCCACCTGCATCGATAGCAACGGG GGCATCTGCA

ACGGCCGAGGCTACTGTGAGTGTGGCCGTTGTCACTGCAACCAGCAGTCGCTCTACACGGACACCACCTGTGAGATCAACTACTCTGCG ATACGCCTGG

GTCTCTGTGAGGATCTCCGCTCCTGCGTACAGTGCCAGGCCTGGGGCACCGGGGAGAAGAAAGGGCGCGCGTGTGACGATTGCCCCTTTAAAGTCAAGAT

GGTAGACGAGCTTAAGAAAG - UNI34465 - CAGAAGAGGTGGTGGAGTACTGCTCCTTCCGGGATGAGGATGACGACTGCACTTACAGCTACAACG

TGGAGGGCGATGGCAGCCCTGGGCCCAACAGCACAGTCCTGGTCCACAAAAAGAAAG ACTGCCCTCCCGGCTCCTTCTGGTGGCTCATCCCCCTGCTCA

TCTTCCTCCTGTTGCTCCTGGCGTTGCTTCTGCTGCTCTGCTGGAAATACTGTGCCTGCTGCAAA GCCTGCCTGGGGCTTCTTCCTTGCTGCAACCGAG

 GTCACATGGTGGGCTTTAAGGAAGATCACTATATGCTTCGGGAGAACCTGATGGCCTCTGACCACCTGGACACGCCCATGCTACGAAGCGGGAACCTCA

AGGGACGAGACACAGTCCGCTGGAAGATCACCAACAATGTGCAGCGCCCTGGCTTTGCCACCCATGCCGCCAGCACCAGCCCCACGGAGCTCG TACCCT

ACGGGCTGTCCCTGCGCCTTGGCCGCCTCTGCACTGAGAACCTTATGAAGCCGGGCACCCGAGAGTGTGACCAGCTACGCCAGGAGGTGGAGGAAAAT C

TGAATGAGGTGTATAGACAGGTCAGCGGCGCACACAAGCTCCAGCAGACGAAGTTCCG ACAGCAGCCCAACACCGGGAAAAA GCAAGACCACACCATT

GTGGACACAGTGTTGCTGGCGCCCCGCTCCGCCAAGCAGATGCTGCTGAAGCTGACAGAGAAGCAGGTGGAGCAGGGGTCCTTCCATGAACTGAAGGTGG

CCCCTGGCTACTACACTGTCACGGCAGAGCAGG ATGCCCGGGGCATGGTGGAGTTCCAGGAGGGCGTGGAGCTGGTGGATGTGCGAGTGCCCCTCTTCA

TCCGGCCTGAGGATGATGATGAGAAGCAGCTGCTGGTGGAGGCCATTGATGTCCCTGTGGGCACTGCCACCCTTGGTCGCCGTCTGGTAAACATCACCAT

TATCAAGGAACAAG CTAGTGGGGTAGTGTCCTTCGAGCAGCCTGAATACTCGGTGAGTCGTGGAGACCAGGTGGCCCGCATCCCTGTCATCCGGCACAT

CCTGGACAATGGCAAGTCCCAGGTCTCCTATAGCACACAGGATAATACAGCACACGGACACCGG GATTATGTCCCTGTGGAGGGAGAGCTGCTGTTCCA

TCCTGGGGAGACCTGGAAGGAGTTGCAGGTGAAGCTACTGGAGCTGCAGGAGGTCGACTCCCTCCTGCGTGGCCGCCAGGTCCGCCGCTTCCAAGTCCAA

CTCAGCAACCCCAAGTTCGGAGCCCGCCTGGGCCAGCCCAGCACAACCACCGTTATTCTCGGTGAGCACG ATGAAACGGACAGGAGTCTCATAAATCAA

ACACTTTCATCGCCTCCGCCACCCCATGGAGACCTGGGCGCCCCACAGAACCCCAATGCCAAGGCTGCCGGGTCCAGGAAGATCCATTTCAACTGGCTGC

CCCCTCCTGGCAAGCCAATGGGGTACAGG GTGAAGTACTGGATCCAGGGCGACTCTGAGTCTGAAGCCCACCTTCTAGACAGCAAGGTGCCCTCAGTGG

AACTCACCAACCTGTATCCCTATTGCGACTACGAAATGAAGGTGTGTGCCTATGGGGCACAGGGTGAGGGGCCCTATAGCTCACTGGTGTCCTGCCGCAC

CCACCAGGAAG TACCCAGCGAGCCAGGGAGGCTGGCTTTCAATGTAGTCTCTTCTACGGTGACGCAGCTGAGCTGGGCAGAGCCAGCTGAGACCAATGG

CGAGATCACAGCCTACGAGGTCTGCTATGGACTGGTCAATGAGGACAACC GACCCATTGGACCTATGAAGAAGGTGCTCGTGGACAACCCCAAGAACCG

GATGCTGCTCATTGAGAATCTGCGAGAATCCCAGCCATACCGATACACGGTTAAGGCGCGCAATGGGGCAGGATGGGGACCCGAGAGAGAGGCTATCATC

AACCTGGCTACACAGCCCAAGCGGCCCATGTCCA TCCCTATCATCCCAGACATCCCCATAGTGGACGCCCAGGGTGGAGAAGACTACGAAAACTTCCTT

ATGTACAGTGATGACGTCCTGCGGTCCCCAGCCAGCAGCCAGAGGCCCAGCGTTTCTGATGACACTG AGCACCTGGTGAATGGCCGGATGGACTTTGCC

TATCCAGGCAGCGCCAACTCCCTGCACAGAATGACTGCAGCCAATGTGGCCTATGGCACGCATCTGAGCCCACACCTGTCCCACCGAGTGCTGAGCACGT

CCTCCACCCTTACCCGGGACTACCACTCTCTGACACGCACAGAGCACTCCCACTCAGGCACACTTCCCAGGGACTACTCCACCCTCACTTCCCTTTCCTC

CCAAG ATTCCCGTGGGGCTGTGGGTGTGCCTGACACACCCACTCGGCTGGTGTTCTCTGCCCTGGGGCCCACGTCTTTGAAGGTGAGCTGGCAGGAGCC

ACAGTGTGATCGGATGCTGCTGGGCTACAGTGTGGAATACCAGCTACTAAACGGCG GCGAGATGCATCGGCTCAACATCCCTAACCCTGGCCAAACCTC

GGTGGTGGTAGAGGATCTCCTGCCTAACCACTCCTATGTGTTCCGGGTACGGGCCCAGAGCCAGGAGGGCTGGGGCCGAGAGCGAGAGGGTGTCATCACC

ATCGAGTCCCAGGTGCACCCGCAGAGCCCTCTCTGCCCCCTGCCAG GCTCAGCCTTCACTCTGAGCACCCCCAGCGCCCCGGGACCGCTGGTGTTCACT

GCCCTAAGCCCAGACTCCCTGCAGCTCAGCTGGGAGCGGCCGAGGAGGCCCAATGGAGATATCCTTGGCTACCTGGTGACCTGTGAGATGGCCCAAGGAG

GAG CACCAGCCAGGACCTTCCGGGTGGACGGAGACAACCCTGAGAGCCGGTTGACTGTACCTGGCCTCAGTGAGAACGTTCCTTACAAGTTCAAGGTTC

AGGCCAGGACGACCGAGGGCTTCGGGCCAGAGCGTGAGGGTATCATCACCATCGAGTCTCAGGTTGGAG GCCCCTTCCCACAGCTGGGCAGCCATTCTG

GGCTCTTCCAGAACCCAGTGCAAAGCGAGTTCAGCAGCGTGACCAGCACGCACAGCACCACGACTGAGCCCTTCCTCATGG ATGGTCTAACCCTGGGGA

CCCAGCGCCTGGAAGCAGGAGGCTCCCTCACCCGGCATGTGACCCAGGAATTCGTGACCCGGACCTTAACGGCCAGTGGCTCTCTCAGCACTCATATGGA

CCAACAGTTCTTCCAAACCTGAACCTCCCCCGCGCCCCAGCCACCTGGGCCCCTCCTTGCCTCCTCTCCTAGCGCCTTCTTCCTCTGCTGCTCTACCCAC

GAGCTTGCTGACCACAGAGCCAGCCCCTGTAGTCAGAGAGCAGGGGTAGGTGCTGTCCAGGAACCATAAAGTGGGTAGAGGTGATACAAGGTCTTTCTGA

CTGCATCCCACCCTGGGTCCAATCCCACATGTAACCAAAAAAAAAAAAAAAAAAACCAAAAAACAAAAAACTGGAGCTGGCACAAGTCCCCAGCCTTTTG

TTCTGCACTTAATAAAAGGTTTTGCTACTGCTTA
Translation
MAGPCCSPWVKLLLLAAMLSASLPGDLA ANRCKKAQVKSCTECIRVDKSCAYCTDE LFKERRCNTQAELLAAGCRGESILVMESSLEITE NTQIDTS

LHRSQVSPQGLQVRLRPGEERSFVFQVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLA AKILRQLTSDYTIGFGKFVDKVSVPQTDMRPEK KLK

EPWPNSDPPFSFKNVISLTENVEEFWNKLQGERISGNLDAPEGGFDAILQTAVCT RDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHL

DASGAYTQYKTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYE KLHKYFPVSSLGVLQEDSSNIVELLEEAFY RIRSNLDIRALDSPRGLRTEVTSD

TLQKTETGSFHIKRGEV GTYNVHLRAVEDIDGTHVCQLAKEDQGGNIHLKPSFSDGLRMDASVICDVCPCEL QKEVRSARCHFRGDFMCGHCVCNEGW

 WSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSGFLCND DRGRCSMGECVCEPGWTGRSCDCPLSNAT

CIDSNG GICNGRGYCECGRCHCNQQSLYTDTTCEINYSA IRLGLCEDLRSCVQCQAWGTGEKKGRACDDCPFKVKMVDELKKA - UNI34465 - A

EEVVEYCSFRDEDDDCTYSYNVEGDGSPGPNSTVLVHKKKD DCPPGSFWWLIPLLIFLLLLLALLLLLCWKYCACCK ACLGLLPCCNRG GHMVGFKE

DHYMLRENLMASDHLDTPMLRSGNLKGRDTVRWKITNNVQRPGFATHAASTSPTELV VPYGLSLRLGRLCTENLMKPGTRECDQLRQEVEEN LNEVYR

QVSGAHKLQQTKFR RQQPNTGKK KQDHTIVDTVLLAPRSAKQMLLKLTEKQVEQGSFHELKVAPGYYTVTAEQD DARGMVEFQEGVELVDVRVPLFI

RPEDDDEKQLLVEAIDVPVGTATLGRRLVNITIIKEQA ASGVVSFEQPEYSVSRGDQVARIPVIRHILDNGKSQVSYSTQDNTAHGHR DYVPVEGELL

FHPGETWKELQVKLLELQEVDSLLRGRQVRRFQVQLSNPKFGARLGQPSTTTVILGEHD DETDRSLINQTLSSPPPPHGDLGAPQNPNAKAAGSRKIHF

NWLPPPGKPMGYR VKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQEV VPSEPGRLAFNVVSSTVTQLSWAE

PAETNGEITAYEVCYGLVNEDNR RPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSI IPIIPDIPIVDAQ

GGEDYENFLMYSDDVLRSPASSQRPSVSDDTE EHLVNGRMDFAYPGSANSLHRMTAANVAYGTHLSPHLSHRVLSTSSTLTRDYHSLTRTEHSHSGTLP

RDYSTLTSLSSQD DSRGAVGVPDTPTRLVFSALGPTSLKVSWQEPQCDRMLLGYSVEYQLLNGG GEMHRLNIPNPGQTSVVVEDLLPNHSYVFRVRAQ

SQEGWGREREGVITIESQVHPQSPLCPLPG GSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGA APARTFRVDGDNPES

RLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQVGG GPFPQLGSHSGLFQNPVQSEFSSVTSTHSTTTEPFLMD DGLTLGTQRLEAGGSLTRH

VTQEFVTRTLTASGSLSTHMDQQFFQT
Transcript ENSMUST00000106458
Sequence
GAGGAGGAGGATGGCAGGGCCCTGTTGCAGCCCATGGGTGAAGCTGCTGCTGCTGGCAGCAATGCTGAGTGCCAGCCTCCCTGGAGACCTGG CCAACCG

CTGCAAGAAGGCTCAGGTGAAGAGCTGTACCGAGTGCATCCGGGTGGACAAGAGCTGTGCCTACTGCACAGACGAG CTGTTCAAGGAGAGGCGCTGCAA

CACCCAGGCGGAGCTTCTGGCTGCAGGCTGCAGGGGAGAGAGCATCCTGGTCATGGAGAGCAGCCTTGAAATCACAGAG AACACCCAGATCGACACCAG

CCTGCACCGCAGCCAGGTATCTCCCCAAGGCCTGCAAGTCCGGCTGCGGCCGGGTGAGGAGCGCAGCTTTGTGTTCCAGGTGTTTGAGCCCCTGGAGAGC

CCCGTGGATCTGTATATCCTCATGGACTTCTCCAACTCCATGTCTGACGATCTGGACAACCTCAAGCAGATGGGGCAGAACCTGG CCAAGATCCTGCGC

CAGCTCACCAGCGACTACACCATTGGATTTGGAAAGTTTGTGGACAAAGTCAGCGTCCCACAGACAGACATGAGGCCCGAGAA ACTGAAGGAGCCCTGG

CCCAACAGTGATCCCCCGTTCTCCTTCAAGAACGTTATCAGCTTAACGGAGAATGTGGAAGAATTCTGGAACAAACTGCAAGGAGAACGCATCTCAGGCA

ACCTGGACGCTCCTGAAGGGGGCTTTGATGCCATCCTGCAGACAGCTGTGTGCACA AGGGACATTGGCTGGAGGGCTGACAGCACCCACCTGCTGGTGT

TCTCCACCGAGTCTGCCTTCCACTACGAGGCTGATGGTGCCAACGTGCTGGCCGGCATCATGAACCGCAATGATGAGAAATGCCACCTGGACGCCTCGGG

CGCCTACACCCAATACAAGACACAGGACTACCCATCAGTGCCCACGCTGGTTCGCCTGCTTGCCAAGCATAACATCATCCCCATCTTTGCTGTCACCAAC

TACTCTTACAGCTACTATGAG AAGCTCCATAAGTATTTCCCCGTCTCCTCTCTGGGCGTCCTGCAGGAGGATTCATCCAACATCGTGGAGCTGCTGGAG

GAGGCCTTCTAT CGAATTCGCTCCAACCTGGACATCCGGGCTCTGGACAGCCCCAGAGGCCTGAGAACAGAGGTCACCTCCGATACTCTCCAGAAGACG

GAGACTGGGTCCTTTCACATCAAGCGGGGGGAAGTG GGCACATACAATGTGCATCTCCGGGCAGTGGAGGACATAGATGGGACACATGTGTGCCAGCTG

GCTAAAGAAGACCAAGGGGGCAACATCCACCTGAAACCCTCCTTCTCTGATGGCCTCCGGATGGACGCGAGTGTGATCTGTGACGTGTGCCCCTGTGAGC

TG CAAAAGGAAGTTCGATCAGCTCGCTGTCACTTCAGAGGAGACTTCATGTGTGGACACTGTGTGTGCAATGAGGGCTG GAGTGGCAAAACCTGCAAC

TGCTCCACCGGCTCTCTGAGTGACACACAGCCCTGCCTGCGTGAGGGTGAGGACAAACCGTGCTCGGGCCACGGCGAGTGCCAGTGCGGACGCTGTGTGT

GCTATGGTGAAGGCCGCTACGAGGGTCACTTCTGCGAGTATGACAACTTCCAGTGTCCCCGGACCTCTGGATTCCTGTGCAATG ACCGGGGTCGCTGTT

CTATGGGAGAGTGTGTGTGTGAGCCTGGTTGGACAGGCCGCAGCTGTGACTGTCCCCTCAGCAATGCCACCTGCATCGATAGCAACGGG GGCATCTGCA

ACGGCCGAGGCTACTGTGAGTGTGGCCGTTGTCACTGCAACCAGCAGTCGCTCTACACGGACACCACCTGTGAGATCAACTACTCTGCG ATACGCCTGG

GTCTCTGTGAGGATCTCCGCTCCTGCGTACAGTGCCAGGCCTGGGGCACCGGGGAGAAGAAAGGGCGCGCGTGTGACGATTGCCCCTTTAAAGTCAAGAT

GGTAGACGAGCTTAAGAAAG - UNI34465 - CAGAAGAGGTGGTGGAGTACTGCTCCTTCCGGGATGAGGATGACGACTGCACTTACAGCTACAACG

TGGAGGGCGATGGCAGCCCTGGGCCCAACAGCACAGTCCTGGTCCACAAAAAGAAAG ACTGCCCTCCCGGCTCCTTCTGGTGGCTCATCCCCCTGCTCA

TCTTCCTCCTGTTGCTCCTGGCGTTGCTTCTGCTGCTCTGCTGGAAATACTGTGCCTGCTGCAAA GCCTGCCTGGGGCTTCTTCCTTGCTGCAACCGAG

 GTCACATGGTGGGCTTTAAGGAAGATCACTATATGCTTCGGGAGAACCTGATGGCCTCTGACCACCTGGACACGCCCATGCTACGAAGCGGGAACCTCA

AGGGACGAGACACAGTCCGCTGGAAGATCACCAACAATGTGCAGCGCCCTGGCTTTGCCACCCATGCCGCCAGCACCAGCCCCACGGAGCTCG TACCCT

ACGGGCTGTCCCTGCGCCTTGGCCGCCTCTGCACTGAGAACCTTATGAAGCCGGGCACCCGAGAGTGTGACCAGCTACGCCAGGAGGTGGAGGAAAAT C

TGAATGAGGTGTATAGACAGGTCAGCGGCGCACACAAGCTCCAGCAGACGAAGTTCCG ACAGCAGCCCAACACCGGGAAAAA GCAAGACCACACCATT

GTGGACACAGTGTTGCTGGCGCCCCGCTCCGCCAAGCAGATGCTGCTGAAGCTGACAGAGAAGCAGGTGGAGCAGGGGTCCTTCCATGAACTGAAGGTGG

CCCCTGGCTACTACACTGTCACGGCAGAGCAGG ATGCCCGGGGCATGGTGGAGTTCCAGGAGGGCGTGGAGCTGGTGGATGTGCGAGTGCCCCTCTTCA

TCCGGCCTGAGGATGATGATGAGAAGCAGCTGCTGGTGGAGGCCATTGATGTCCCTGTGGGCACTGCCACCCTTGGTCGCCGTCTGGTAAACATCACCAT

TATCAAGGAACAAG CTAGTGGGGTAGTGTCCTTCGAGCAGCCTGAATACTCGGTGAGTCGTGGAGACCAGGTGGCCCGCATCCCTGTCATCCGGCACAT

CCTGGACAATGGCAAGTCCCAGGTCTCCTATAGCACACAGGATAATACAGCACACGGACACCGG GATTATGTCCCTGTGGAGGGAGAGCTGCTGTTCCA

TCCTGGGGAGACCTGGAAGGAGTTGCAGGTGAAGCTACTGGAGCTGCAGGAGGTCGACTCCCTCCTGCGTGGCCGCCAGGTCCGCCGCTTCCAAGTCCAA

CTCAGCAACCCCAAGTTCGGAGCCCGCCTGGGCCAGCCCAGCACAACCACCGTTATTCTCGGTGAGCACG ATGAAACGGACAGGAGTCTCATAAATCAA

ACACTTTCATCGCCTCCGCCACCCCATGGAGACCTGGGCGCCCCACAGAACCCCAATGCCAAGGCTGCCGGGTCCAGGAAGATCCATTTCAACTGGCTGC

CCCCTCCTGGCAAGCCAATGGGGTACAGG GTGAAGTACTGGATCCAGGGCGACTCTGAGTCTGAAGCCCACCTTCTAGACAGCAAGGTGCCCTCAGTGG

AACTCACCAACCTGTATCCCTATTGCGACTACGAAATGAAGGTGTGTGCCTATGGGGCACAGGGTGAGGGGCCCTATAGCTCACTGGTGTCCTGCCGCAC

CCACCAGGAAG TACCCAGCGAGCCAGGGAGGCTGGCTTTCAATGTAGTCTCTTCTACGGTGACGCAGCTGAGCTGGGCAGAGCCAGCTGAGACCAATGG

CGAGATCACAGCCTACGAGGTCTGCTATGGACTGGTCAATGAGGACAACC GACCCATTGGACCTATGAAGAAGGTGCTCGTGGACAACCCCAAGAACCG

GATGCTGCTCATTGAGAATCTGCGAGAATCCCAGCCATACCGATACACGGTTAAGGCGCGCAATGGGGCAGGATGGGGACCCGAGAGAGAGGCTATCATC

AACCTGGCTACACAGCCCAAGCGGCCCATGTCCA TCCCTATCATCCCAGACATCCCCATAGTGGACGCCCAGGGTGGAGAAGACTACGAAAACTTCCTT

ATGTACAGTGATGACGTCCTGCGGTCCCCAGCCAGCAGCCAGAGGCCCAGCGTTTCTGATGACACTG GCTGCGGCTGGAAGTTCGAGCCTCTGCTCGGG

GAGGAGCTGGACCTGCGGCGCGTCACGTGGCGGCTACCCCCGGAACTCATCCCGCGCCTGTCCGCCAGCAGCGGGCGCTCTGACGAAGACGGCAGCGTTG

CGGGGGGCGTGGAAGGGGAGGGCAGCGGCTGGATCCGCGGGGCTACGCCCCGACCCCCGGGAG AGCACCTGGTGAATGGCCGGATGGACTTTGCCTATC

CAGGCAGCGCCAACTCCCTGCACAGAATGACTGCAGCCAATGTGGCCTATGGCACGCATCTGAGCCCACACCTGTCCCACCGAGTGCTGAGCACGTCCTC

CACCCTTACCCGGGACTACCACTCTCTGACACGCACAGAGCACTCCCACTCAGGCACACTTCCCAGGGACTACTCCACCCTCACTTCCCTTTCCTCCCAA

G ATTCCCGTGGGGCTGTGGGTGTGCCTGACACACCCACTCGGCTGGTGTTCTCTGCCCTGGGGCCCACGTCTTTGAAGGTGAGCTGGCAGGAGCCACAG

TGTGATCGGATGCTGCTGGGCTACAGTGTGGAATACCAGCTACTAAACGGCG GCGAGATGCATCGGCTCAACATCCCTAACCCTGGCCAAACCTCGGTG

GTGGTAGAGGATCTCCTGCCTAACCACTCCTATGTGTTCCGGGTACGGGCCCAGAGCCAGGAGGGCTGGGGCCGAGAGCGAGAGGGTGTCATCACCATCG

AGTCCCAGGTGCACCCGCAGAGCCCTCTCTGCCCCCTGCCAG GCTCAGCCTTCACTCTGAGCACCCCCAGCGCCCCGGGACCGCTGGTGTTCACTGCCC

TAAGCCCAGACTCCCTGCAGCTCAGCTGGGAGCGGCCGAGGAGGCCCAATGGAGATATCCTTGGCTACCTGGTGACCTGTGAGATGGCCCAAGGAGGAG 

CACCAGCCAGGACCTTCCGGGTGGACGGAGACAACCCTGAGAGCCGGTTGACTGTACCTGGCCTCAGTGAGAACGTTCCTTACAAGTTCAAGGTTCAGGC

CAGGACGACCGAGGGCTTCGGGCCAGAGCGTGAGGGTATCATCACCATCGAGTCTCAGGTTGGAG GCCCCTTCCCACAGCTGGGCAGCCATTCTGGGCT

CTTCCAGAACCCAGTGCAAAGCGAGTTCAGCAGCGTGACCAGCACGCACAGCACCACGACTGAGCCCTTCCTCATGG ATGGTCTAACCCTGGGGACCCA

GCGCCTGGAAGCAGGAGGCTCCCTCACCCGGCATGTGACCCAGGAATTCGTGACCCGGACCTTAACGGCCAGTGGCTCTCTCAGCACTCATATGGACCAA

CAGTTCTTCCAAACCTGAACCTCCCCCGCGCCCCAGCCACCTGGGCCCCTCCTTGCCTCCTCTCCTAGCGCCTTCTTCCTCTGCTGCTCTACCCACGAGC

TTGCTGACCACAGAGCCAGCCCCTGTAGTCAGAGAGCAGGGGTAGGTGCTGTCCAGGAACCATAAAGTGGGTAGAGGTGATACAAGGTCTTTCTGACTGC

ATCCCACCCTGGGTCCAATCCCACATGTAACCAAAAAAAAAAAAAAAAAAACCAAAAAACAAAAAACTGGAGCTGGCACAAGTCCCCAGCCTTTTGTTCT

GCACTTAATAAAAGGTTTTGCTACTGCTTA
Translation
MAGPCCSPWVKLLLLAAMLSASLPGDLA ANRCKKAQVKSCTECIRVDKSCAYCTDE LFKERRCNTQAELLAAGCRGESILVMESSLEITE NTQIDTS

LHRSQVSPQGLQVRLRPGEERSFVFQVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLA AKILRQLTSDYTIGFGKFVDKVSVPQTDMRPEK KLK

EPWPNSDPPFSFKNVISLTENVEEFWNKLQGERISGNLDAPEGGFDAILQTAVCT RDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHL

DASGAYTQYKTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYE KLHKYFPVSSLGVLQEDSSNIVELLEEAFY RIRSNLDIRALDSPRGLRTEVTSD

TLQKTETGSFHIKRGEV GTYNVHLRAVEDIDGTHVCQLAKEDQGGNIHLKPSFSDGLRMDASVICDVCPCEL QKEVRSARCHFRGDFMCGHCVCNEGW

 WSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSGFLCND DRGRCSMGECVCEPGWTGRSCDCPLSNAT

CIDSNG GICNGRGYCECGRCHCNQQSLYTDTTCEINYSA IRLGLCEDLRSCVQCQAWGTGEKKGRACDDCPFKVKMVDELKKA - UNI34465 - A

EEVVEYCSFRDEDDDCTYSYNVEGDGSPGPNSTVLVHKKKD DCPPGSFWWLIPLLIFLLLLLALLLLLCWKYCACCK ACLGLLPCCNRG GHMVGFKE

DHYMLRENLMASDHLDTPMLRSGNLKGRDTVRWKITNNVQRPGFATHAASTSPTELV VPYGLSLRLGRLCTENLMKPGTRECDQLRQEVEEN LNEVYR

QVSGAHKLQQTKFR RQQPNTGKK KQDHTIVDTVLLAPRSAKQMLLKLTEKQVEQGSFHELKVAPGYYTVTAEQD DARGMVEFQEGVELVDVRVPLFI

RPEDDDEKQLLVEAIDVPVGTATLGRRLVNITIIKEQA ASGVVSFEQPEYSVSRGDQVARIPVIRHILDNGKSQVSYSTQDNTAHGHR DYVPVEGELL

FHPGETWKELQVKLLELQEVDSLLRGRQVRRFQVQLSNPKFGARLGQPSTTTVILGEHD DETDRSLINQTLSSPPPPHGDLGAPQNPNAKAAGSRKIHF

NWLPPPGKPMGYR VKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQEV VPSEPGRLAFNVVSSTVTQLSWAE

PAETNGEITAYEVCYGLVNEDNR RPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSI IPIIPDIPIVDAQ

GGEDYENFLMYSDDVLRSPASSQRPSVSDDTG GCGWKFEPLLGEELDLRRVTWRLPPELIPRLSASSGRSDEDGSVAGGVEGEGSGWIRGATPRPPGE 

EHLVNGRMDFAYPGSANSLHRMTAANVAYGTHLSPHLSHRVLSTSSTLTRDYHSLTRTEHSHSGTLPRDYSTLTSLSSQD DSRGAVGVPDTPTRLVFSA

LGPTSLKVSWQEPQCDRMLLGYSVEYQLLNGG GEMHRLNIPNPGQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPG GS

AFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGA APARTFRVDGDNPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGII

TIESQVGG GPFPQLGSHSGLFQNPVQSEFSSVTSTHSTTTEPFLMD DGLTLGTQRLEAGGSLTRHVTQEFVTRTLTASGSLSTHMDQQFFQT

For any suggestions or comments, please send an email to unitrap@crg.es