Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020792 (Exoc7)
Chromosomal location
Chr 11: 116150424 - 116168298 (-)
Description
exocyst complex component 7 Gene [Source:MGI (curated);Acc:Exoc7-001]
RefSeq_dna
NM_016857 
RefSeq_peptide
NP_058553.1 
UniGene
Mm.470428 
MGI
MGI:1859270 
Uniprot/SWISSPROT
O35250 
Uniprot/SPTREMBL
Q3USE0 A2AAN0 Q3TIP4 Q542L0 Q69ZS4 Q7TPT3 A2AAN3 A2AAN5 A2AAN4 
Human Ortholog
ENSG00000182473 (EXOC7)
Omim not available
UniTrap UNI31736
Vector Insertion
Chr 11: 116167927 - 116168299
Public Clones IST14100A8 (tigm) IST13738B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021147
Sequence
GCAGGGTTTGGAGCTAAAACAGCGGGGAGTGGGGACAGCGCTGTCCGCTGCTATGATTCCCCCGCAGGAGGCTTCCGCCCGGCGGCGGGAGATCGAGGAC

AAACTGAAGCAG - UNI31736 - GAGGAGGAGACGCTGTCGTTTATCCGAGACAGCCTGGAGAAGAGCGACCAGCTCACTAGGAACATG GTGTCCA

TCCTGTCGTCCTTTGAGAGCCGACTCATGAAGCTGGAGAACTCTATCATCCCTGTGCACAAGCAGACAGAGAACCTACAGAGGCTGCAGGAGAACGTGGA

GAAGACGTTATCCTGCCTGGACCACGTTATCAGCTACTACCACGTAGCCAGCGACACGGAGAAGATCATCCGAGAGGG CCCCACAGGTAGGCTGGAAGA

GTACCTGGGAAGTATGGCCAAAATCCAGAAGGCTGTGGAGTATTTTCAGGACAATAGCCCAGACAGCCCAGAACTCAACAAAGTG AAGCTGCTGTTTGA

GCGAGGGAAGGAGTCCCTGGAGTCGGAGTTCCGCAGTCTGATGACCCGGCACAGCAAGGTGGTCTCCCCCGTGCTCCTCCTGGACCTCATCAGTGCTGAC

GACGAGCTGGAGGTGCAGGAGGACGTGGTCCTGGAGCACCTGCCCGAGAGCGTGCTCAGAGACGTGGTCCGCATCTCCCGCTGGCTGGTGGAATATGGTC

GGAACCAAG ACTTCATGAATGTCTACTACCAGATCCGCTCCAGCCAGCTGGACCGCTCCATCAAGGGTCTGAAGGAGCATTTTCGCAAAAGCAGTTCCT

CTTCTGGGGTTCCCTACTCCCCCGCCATCCCCAATAAGAGGAAAGACACGCCCACCAAGAAGCCCATCAAGCGGCCAG GGACGATCCGTAAGGCTCAGA

ACCTTCTGAAACAGTATTCCCAGCATGGTCTAGATGGGAAAAAGGGGGGCTCTAACCTCATTCCTCTGGAAG GGAGAGACGACATGCTGGACGTGGAGA

CGGACGCCTACATTCACTGCGTCAGTGCCTTCGTCAAGCTGGCGCAGAGTGAATACCGGCTGCTGATGGAGATCATCCCTGAGCATCACCAGAAGAAAAC

CTTTGACTCCTTGATACAG GATGCCCTGGACGGGCTGATGCTTGAAGGGGAGAACATCGTGTCTGCTGCCAGGAAAGCCATCATCCGCCATGACTTCTC

CACAGTGCTCACCGTCTTCCCCATCCTGCGGCACCTCAAGCAGACCAAGCCCGAGTTTGACCAGGTGCTCCAG GGCACAGCAGCCAGCACCAAGAACAA

GCTGCCCGGCCTCATCACCTCCATGGAGACCATTGGGGCCAAAGCTCTAGAAGACTTTGCTGATAACATCAAG AATGATCCAGACAAGGAATACAACAT

GCCTAAAGACGGCACTGTTCATGAGCTCACAAGCAAT GCCATCCTGTTCCTACAGCAGCTTCTGGACTTCCAGGAGACAGCAGGTGCCATGCTGGCCTC

CCAAG TTCTTGGGGACACATACAATATTCCTTTAGACCCCCGAG AAACCAGCTCTTCGGCCACCAGCTACAGCTCCGAGTTCAGCAAGCGGCTGCTGA

GCACCTACATCT GCAAAGTCTTGGGTAACCTGCAGCTGAACTTACTAAGCAAGTCCAAGGTGTACGAGGATCCAGCGCTGAGCGCCATCTTCCTACACA

ACAACTACAATTACATCCTCAAGTCCCTGGAGAA GTCTGAGCTGATCCAGCTGGTGGCTGTAACCCAGAAGACTGCCGAGCGCTCCTACCGGGAGCACA

TCGAGCAGCAGATCCAGACCTACCAGCGCAG CTGGCTAAAGGTGACTGACTACATCGCAGAGAAGAACCTACCTGTGTTCCAGCCTGGAGTCAAG CTC

CGGGACAAAGAGCGGCAGATGATTAAGGAACGTTTCAAG GGGTTCAATGATGGACTCGAAGAGCTGTGCAAGATTCAGAAGGTCTGGGCTATTCCAGAC

ACAGAGCAGAGAGACAAGATTCGACAGGCTCAGAAAGACATTGTCAAGGAGACCTACGGGGCCTTTCTGCACAG GTATGGCAGCGTGCCCTTCACCAAA

AACCCGGAGAAATACATTAAGTACCGCGTGGAGCAGGTGGGAGACATGATCGATCGCCTTTTCGACACCTCTGCTTGAGTCTGCCAGTGTTTCTGCCCAG

TTCTGCCGGCATGCCTAGCATGTCATTGGACTCATAAACCAGTGGTAACTC
Translation
MIPPQEASARRREIEDKLKQ - UNI31736 - EEETLSFIRDSLEKSDQLTRNM VSILSSFESRLMKLENSIIPVHKQTENLQRLQENVEKTLSCLD

HVISYYHVASDTEKIIREG GPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKV KLLFERGKESLESEFRSLMTRHSKVVSPVLLLDLISADDELEV

QEDVVLEHLPESVLRDVVRISRWLVEYGRNQD DFMNVYYQIRSSQLDRSIKGLKEHFRKSSSSSGVPYSPAIPNKRKDTPTKKPIKRPG GTIRKAQNL

LKQYSQHGLDGKKGGSNLIPLEG GRDDMLDVETDAYIHCVSAFVKLAQSEYRLLMEIIPEHHQKKTFDSLIQ DALDGLMLEGENIVSAARKAIIRHDF

STVLTVFPILRHLKQTKPEFDQVLQ GTAASTKNKLPGLITSMETIGAKALEDFADNIK NDPDKEYNMPKDGTVHELTSN AILFLQQLLDFQETAGAM

LASQV VLGDTYNIPLDPRE ETSSSATSYSSEFSKRLLSTYIC CKVLGNLQLNLLSKSKVYEDPALSAIFLHNNYNYILKSLEK KSELIQLVAVTQK

TAERSYREHIEQQIQTYQRS SWLKVTDYIAEKNLPVFQPGVK LRDKERQMIKERFK GFNDGLEELCKIQKVWAIPDTEQRDKIRQAQKDIVKETYGA

FLHR RYGSVPFTKNPEKYIKYRVEQVGDMIDRLFDTSA
Transcript ENSMUST00000106413
Sequence
GCAGGGTTTGGAGCTAAAACAGCGGGGAGTGGGGACAGCGCTGTCCGCTGCTATGATTCCCCCGCAGGAGGCTTCCGCCCGGCGGCGGGAGATCGAGGAC

AAACTGAAGCAG - UNI31736 - GAGGAGGAGACGCTGTCGTTTATCCGAGACAGCCTGGAGAAGAGCGACCAGCTCACTAGGAACATG GTGTCCA

TCCTGTCGTCCTTTGAGAGCCGACTCATGAAGCTGGAGAACTCTATCATCCCTGTGCACAAGCAGACAGAGAACCTACAGAGGCTGCAGGAGAACGTGGA

GAAGACGTTATCCTGCCTGGACCACGTTATCAGCTACTACCACGTAGCCAGCGACACGGAGAAGATCATCCGAGAGGG CCCCACAGGTAGGCTGGAAGA

GTACCTGGGAAGTATGGCCAAAATCCAGAAGGCTGTGGAGTATTTTCAGGACAATAGCCCAGACAGCCCAGAACTCAACAAAGTG AAGCTGCTGTTTGA

GCGAGGGAAGGAGTCCCTGGAGTCGGAGTTCCGCAGTCTGATGACCCGGCACAGCAAGGTGGTCTCCCCCGTGCTCCTCCTGGACCTCATCAGTGCTGAC

GACGAGCTGGAGGTGCAGGAGGACGTGGTCCTGGAGCACCTGCCCGAGAGCGTGCTCAGAGACGTGGTCCGCATCTCCCGCTGGCTGGTGGAATATGGTC

GGAACCAAG ACTTCATGAATGTCTACTACCAGATCCGCTCCAGCCAGCTGGACCGCTCCATCAAGGGTCTGAAGGAGCATTTTCGCAAAAGCAGTTCCT

CTTCTGGGGTTCCCTACTCCCCCGCCATCCCCAATAAGAGGAAAGACACGCCCACCAAGAAGCCCATCAAGCGGCCAG GGACGATCCGTAAGGCTCAGA

ACCTTCTGAAACAGTATTCCCAGCATGGTCTAGATGGGAAAAAGGGGGGCTCTAACCTCATTCCTCTGGAAG GGAGAGACGACATGCTGGACGTGGAGA

CGGACGCCTACATTCACTGCGTCAGTGCCTTCGTCAAGCTGGCGCAGAGTGAATACCGGCTGCTGATGGAGATCATCCCTGAGCATCACCAGAAGAAAAC

CTTTGACTCCTTGATACAG GATGCCCTGGACGGGCTGATGCTTGAAGGGGAGAACATCGTGTCTGCTGCCAGGAAAGCCATCATCCGCCATGACTTCTC

CACAGTGCTCACCGTCTTCCCCATCCTGCGGCACCTCAAGCAGACCAAGCCCGAGTTTGACCAGGTGCTCCAG GGCACAGCAGCCAGCACCAAGAACAA

GCTGCCCGGCCTCATCACCTCCATGGAGACCATTGGGGCCAAAGCTCTAGAAGACTTTGCTGATAACATCAAG AATGATCCAGACAAGGAATACAACAT

GCCTAAAGACGGCACTGTTCATGAGCTCACAAGCAAT GCCATCCTGTTCCTACAGCAGCTTCTGGACTTCCAGGAGACAGCAGGTGCCATGCTGGCCTC

CCAAG AAACCAGCTCTTCGGCCACCAGCTACAGCTCCGAGTTCAGCAAGCGGCTGCTGAGCACCTACATCT GCAAAGTCTTGGGTAACCTGCAGCTGA

ACTTACTAAGCAAGTCCAAGGTGTACGAGGATCCAGCGCTGAGCGCCATCTTCCTACACAACAACTACAATTACATCCTCAAGTCCCTGGAGAA GTCTG

AGCTGATCCAGCTGGTGGCTGTAACCCAGAAGACTGCCGAGCGCTCCTACCGGGAGCACATCGAGCAGCAGATCCAGACCTACCAGCGCAG CTGGCTAA

AGGTGACTGACTACATCGCAGAGAAGAACCTACCTGTGTTCCAGCCTGGAGTCAAG CTCCGGGACAAAGAGCGGCAGATGATTAAGGAACGTTTCAAG 

GGGTTCAATGATGGACTCGAAGAGCTGTGCAAGATTCAGAAGGTCTGGGCTATTCCAGACACAGAGCAGAGAGACAAGATTCGACAGGCTCAGAAAGACA

TTGTCAAGGAGACCTACGGGGCCTTTCTGCACAG GTATGGCAGCGTGCCCTTCACCAAAAACCCGGAGAAATACATTAAGTACCGCGTGGAGCAGGTGG

GAGACATGATCGATCGCCTTTTCGACACCTCTGCTTGAGTCTGCCAGTGTTTCTGCCCAGTTCTGCCGGCATGCCTAGCATGTCATTGGACTCATAAACC

AGTGGTAACTC
Translation
MIPPQEASARRREIEDKLKQ - UNI31736 - EEETLSFIRDSLEKSDQLTRNM VSILSSFESRLMKLENSIIPVHKQTENLQRLQENVEKTLSCLD

HVISYYHVASDTEKIIREG GPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKV KLLFERGKESLESEFRSLMTRHSKVVSPVLLLDLISADDELEV

QEDVVLEHLPESVLRDVVRISRWLVEYGRNQD DFMNVYYQIRSSQLDRSIKGLKEHFRKSSSSSGVPYSPAIPNKRKDTPTKKPIKRPG GTIRKAQNL

LKQYSQHGLDGKKGGSNLIPLEG GRDDMLDVETDAYIHCVSAFVKLAQSEYRLLMEIIPEHHQKKTFDSLIQ DALDGLMLEGENIVSAARKAIIRHDF

STVLTVFPILRHLKQTKPEFDQVLQ GTAASTKNKLPGLITSMETIGAKALEDFADNIK NDPDKEYNMPKDGTVHELTSN AILFLQQLLDFQETAGAM

LASQE ETSSSATSYSSEFSKRLLSTYIC CKVLGNLQLNLLSKSKVYEDPALSAIFLHNNYNYILKSLEK KSELIQLVAVTQKTAERSYREHIEQQIQ

TYQRS SWLKVTDYIAEKNLPVFQPGVK LRDKERQMIKERFK GFNDGLEELCKIQKVWAIPDTEQRDKIRQAQKDIVKETYGAFLHR RYGSVPFTKN

PEKYIKYRVEQVGDMIDRLFDTSA
Transcript ENSMUST00000106411
Sequence
GCAGGGTTTGGAGCTAAAACAGCGGGGAGTGGGGACAGCGCTGTCCGCTGCTATGATTCCCCCGCAGGAGGCTTCCGCCCGGCGGCGGGAGATCGAGGAC

AAACTGAAGCAG - UNI31736 - GAGGAGGAGACGCTGTCGTTTATCCGAGACAGCCTGGAGAAGAGCGACCAGCTCACTAGGAACATG GTGTCCA

TCCTGTCGTCCTTTGAGAGCCGACTCATGAAGCTGGAGAACTCTATCATCCCTGTGCACAAGCAGACAGAGAACCTACAGAGGCTGCAGGAGAACGTGGA

GAAGACGTTATCCTGCCTGGACCACGTTATCAGCTACTACCACGTAGCCAGCGACACGGAGAAGATCATCCGAGAGGG CCCCACAGGTAGGCTGGAAGA

GTACCTGGGAAGTATGGCCAAAATCCAGAAGGCTGTGGAGTATTTTCAGGACAATAGCCCAGACAGCCCAGAACTCAACAAAGTG AAGCTGCTGTTTGA

GCGAGGGAAGGAGTCCCTGGAGTCGGAGTTCCGCAGTCTGATGACCCGGCACAGCAAGGTGGTCTCCCCCGTGCTCCTCCTGGACCTCATCAGTGCTGAC

GACGAGCTGGAGGTGCAGGAGGACGTGGTCCTGGAGCACCTGCCCGAGAGCGTGCTCAGAGACGTGGTCCGCATCTCCCGCTGGCTGGTGGAATATGGTC

GGAACCAAG ACTTCATGAATGTCTACTACCAGATCCGCTCCAGCCAGCTGGACCGCTCCATCAAGGGTCTGAAGGAGCATTTTCGCAAAAGCAGTTCCT

CTTCTGGGGTTCCCTACTCCCCCGCCATCCCCAATAAGAGGAAAGACACGCCCACCAAGAAGCCCATCAAGCGGCCAG GGAGAGACGACATGCTGGACG

TGGAGACGGACGCCTACATTCACTGCGTCAGTGCCTTCGTCAAGCTGGCGCAGAGTGAATACCGGCTGCTGATGGAGATCATCCCTGAGCATCACCAGAA

GAAAACCTTTGACTCCTTGATACAG GATGCCCTGGACGGGCTGATGCTTGAAGGGGAGAACATCGTGTCTGCTGCCAGGAAAGCCATCATCCGCCATGA

CTTCTCCACAGTGCTCACCGTCTTCCCCATCCTGCGGCACCTCAAGCAGACCAAGCCCGAGTTTGACCAGGTGCTCCAG GGCACAGCAGCCAGCACCAA

GAACAAGCTGCCCGGCCTCATCACCTCCATGGAGACCATTGGGGCCAAAGCTCTAGAAGACTTTGCTGATAACATCAAG AATGATCCAGACAAGGAATA

CAACATGCCTAAAGACGGCACTGTTCATGAGCTCACAAGCAAT GCCATCCTGTTCCTACAGCAGCTTCTGGACTTCCAGGAGACAGCAGGTGCCATGCT

GGCCTCCCAAG AAACCAGCTCTTCGGCCACCAGCTACAGCTCCGAGTTCAGCAAGCGGCTGCTGAGCACCTACATCT GCAAAGTCTTGGGTAACCTGC

AGCTGAACTTACTAAGCAAGTCCAAGGTGTACGAGGATCCAGCGCTGAGCGCCATCTTCCTACACAACAACTACAATTACATCCTCAAGTCCCTGGAGAA

 GTCTGAGCTGATCCAGCTGGTGGCTGTAACCCAGAAGACTGCCGAGCGCTCCTACCGGGAGCACATCGAGCAGCAGATCCAGACCTACCAGCGCAG CT

GGCTAAAGGTGACTGACTACATCGCAGAGAAGAACCTACCTGTGTTCCAGCCTGGAGTCAAG CTCCGGGACAAAGAGCGGCAGATGATTAAGGAACGTT

TCAAG GGGTTCAATGATGGACTCGAAGAGCTGTGCAAGATTCAGAAGGTCTGGGCTATTCCAGACACAGAGCAGAGAGACAAGATTCGACAGGCTCAGA

AAGACATTGTCAAGGAGACCTACGGGGCCTTTCTGCACAG GTATGGCAGCGTGCCCTTCACCAAAAACCCGGAGAAATACATTAAGTACCGCGTGGAGC

AGGTGGGAGACATGATCGATCGCCTTTTCGACACCTCTGCTTGAGTCTGCCAGTGTTTCTGCCCAGTTCTGCCGGCATGCCTAGCATGTCATTGGACTCA

TAAACCAGTGGTAACTC
Translation
MIPPQEASARRREIEDKLKQ - UNI31736 - EEETLSFIRDSLEKSDQLTRNM VSILSSFESRLMKLENSIIPVHKQTENLQRLQENVEKTLSCLD

HVISYYHVASDTEKIIREG GPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKV KLLFERGKESLESEFRSLMTRHSKVVSPVLLLDLISADDELEV

QEDVVLEHLPESVLRDVVRISRWLVEYGRNQD DFMNVYYQIRSSQLDRSIKGLKEHFRKSSSSSGVPYSPAIPNKRKDTPTKKPIKRPG GRDDMLDVE

TDAYIHCVSAFVKLAQSEYRLLMEIIPEHHQKKTFDSLIQ DALDGLMLEGENIVSAARKAIIRHDFSTVLTVFPILRHLKQTKPEFDQVLQ GTAASTK

NKLPGLITSMETIGAKALEDFADNIK NDPDKEYNMPKDGTVHELTSN AILFLQQLLDFQETAGAMLASQE ETSSSATSYSSEFSKRLLSTYIC CKV

LGNLQLNLLSKSKVYEDPALSAIFLHNNYNYILKSLEK KSELIQLVAVTQKTAERSYREHIEQQIQTYQRS SWLKVTDYIAEKNLPVFQPGVK LRDK

ERQMIKERFK GFNDGLEELCKIQKVWAIPDTEQRDKIRQAQKDIVKETYGAFLHR RYGSVPFTKNPEKYIKYRVEQVGDMIDRLFDTSA
Transcript ENSMUST00000106409
Sequence
GCAGGGTTTGGAGCTAAAACAGCGGGGAGTGGGGACAGCGCTGTCCGCTGCTATGATTCCCCCGCAGGAGGCTTCCGCCCGGCGGCGGGAGATCGAGGAC

AAACTGAAGCAG - UNI31736 - GAGGAGGAGACGCTGTCGTTTATCCGAGACAGCCTGGAGAAGAGCGACCAGCTCACTAGGAACATG GTGTCCA

TCCTGTCGTCCTTTGAGAGCCGACTCATGAAGCTGGAGAACTCTATCATCCCTGTGCACAAGCAGACAGAGAACCTACAGAGGCTGCAGGAGAACGTGGA

GAAGACGTTATCCTGCCTGGACCACGTTATCAGCTACTACCACGTAGCCAGCGACACGGAGAAGATCATCCGAGAGGG CCCCACAGGTAGGCTGGAAGA

GTACCTGGGAAGTATGGCCAAAATCCAGAAGGCTGTGGAGTATTTTCAGGACAATAGCCCAGACAGCCCAGAACTCAACAAAGTG AAGCTGCTGTTTGA

GCGAGGGAAGGAGTCCCTGGAGTCGGAGTTCCGCAGTCTGATGACCCGGCACAGCAAGGTGGTCTCCCCCGTGCTCCTCCTGGACCTCATCAGTGCTGAC

GACGAGCTGGAGGTGCAGGAGGACGTGGTCCTGGAGCACCTGCCCGAGAGCGTGCTCAGAGACGTGGTCCGCATCTCCCGCTGGCTGGTGGAATATGGTC

GGAACCAAG ACTTCATGAATGTCTACTACCAGATCCGCTCCAGCCAGCTGGACCGCTCCATCAAGGGTCTGAAGGAGCATTTTCGCAAAAGCAGTTCCT

CTTCTGGGGTTCCCTACTCCCCCGCCATCCCCAATAAGAGGAAAGACACGCCCACCAAGAAGCCCATCAAGCGGCCAG GTCACGAGCATGATTTCCGAG

TTAAGCACCTGTCGGAGGCCCTGAACGACAAGCGCGGGCCACTGGCTG GGAGAGACGACATGCTGGACGTGGAGACGGACGCCTACATTCACTGCGTCA

GTGCCTTCGTCAAGCTGGCGCAGAGTGAATACCGGCTGCTGATGGAGATCATCCCTGAGCATCACCAGAAGAAAACCTTTGACTCCTTGATACAG GATG

CCCTGGACGGGCTGATGCTTGAAGGGGAGAACATCGTGTCTGCTGCCAGGAAAGCCATCATCCGCCATGACTTCTCCACAGTGCTCACCGTCTTCCCCAT

CCTGCGGCACCTCAAGCAGACCAAGCCCGAGTTTGACCAGGTGCTCCAG GGCACAGCAGCCAGCACCAAGAACAAGCTGCCCGGCCTCATCACCTCCAT

GGAGACCATTGGGGCCAAAGCTCTAGAAGACTTTGCTGATAACATCAAG AATGATCCAGACAAGGAATACAACATGCCTAAAGACGGCACTGTTCATGA

GCTCACAAGCAAT GCCATCCTGTTCCTACAGCAGCTTCTGGACTTCCAGGAGACAGCAGGTGCCATGCTGGCCTCCCAAG AAACCAGCTCTTCGGCCA

CCAGCTACAGCTCCGAGTTCAGCAAGCGGCTGCTGAGCACCTACATCT GCAAAGTCTTGGGTAACCTGCAGCTGAACTTACTAAGCAAGTCCAAGGTGT

ACGAGGATCCAGCGCTGAGCGCCATCTTCCTACACAACAACTACAATTACATCCTCAAGTCCCTGGAGAA GTCTGAGCTGATCCAGCTGGTGGCTGTAA

CCCAGAAGACTGCCGAGCGCTCCTACCGGGAGCACATCGAGCAGCAGATCCAGACCTACCAGCGCAG CTGGCTAAAGGTGACTGACTACATCGCAGAGA

AGAACCTACCTGTGTTCCAGCCTGGAGTCAAG CTCCGGGACAAAGAGCGGCAGATGATTAAGGAACGTTTCAAG GGGTTCAATGATGGACTCGAAGAG

CTGTGCAAGATTCAGAAGGTCTGGGCTATTCCAGACACAGAGCAGAGAGACAAGATTCGACAGGCTCAGAAAGACATTGTCAAGGAGACCTACGGGGCCT

TTCTGCACAG GTATGGCAGCGTGCCCTTCACCAAAAACCCGGAGAAATACATTAAGTACCGCGTGGAGCAGGTGGGAGACATGATCGATCGCCTTTTCG

ACACCTCTGCTTGAGTCTGCCAGTGTTTCTGCCCAGTTCTGCCGGCATGCCTAGCATGTCATTGGACTCATAAACCAGTGGTAACTC
Translation
MIPPQEASARRREIEDKLKQ - UNI31736 - EEETLSFIRDSLEKSDQLTRNM VSILSSFESRLMKLENSIIPVHKQTENLQRLQENVEKTLSCLD

HVISYYHVASDTEKIIREG GPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKV KLLFERGKESLESEFRSLMTRHSKVVSPVLLLDLISADDELEV

QEDVVLEHLPESVLRDVVRISRWLVEYGRNQD DFMNVYYQIRSSQLDRSIKGLKEHFRKSSSSSGVPYSPAIPNKRKDTPTKKPIKRPG GHEHDFRVK

HLSEALNDKRGPLAG GRD           
Transcript ENSMUST00000106408
Sequence
ATGGCCTCCTGCTTCAGTCTCCCAGCAAGGGGCTGTCTTTCAAAGGAGCGAGCAAACCAGCCTCTGGCTACGAGGAAAGACCCACGTATGCCTCAG - U

NI31736 - GAGGAGGAGACGCTGTCGTTTATCCGAGACAGCCTGGAGAAGAGCGACCAGCTCACTAGGAACATG GTGTCCATCCTGTCGTCCTTTGA

GAGCCGACTCATGAAGCTGGAGAACTCTATCATCCCTGTGCACAAGCAGACAGAGAACCTACAGAGGCTGCAGGAGAACGTGGAGAAGACGTTATCCTGC

CTGGACCACGTTATCAGCTACTACCACGTAGCCAGCGACACGGAGAAGATCATCCGAGAGGG CCCCACAGGTAGGCTGGAAGAGTACCTGGGAAGTATG

GCCAAAATCCAGAAGGCTGTGGAGTATTTTCAGGACAATAGCCCAGACAGCCCAGAACTCAACAAAGTG AAGCTGCTGTTTGAGCGAGGGAAGGAGTCC

CTGGAGTCGGAGTTCCGCAGTCTGATGACCCGGCACAGCAAGGTGGTCTCCCCCGTGCTCCTCCTGGACCTCATCAGTGCTGACGACGAGCTGGAGGTGC

AGGAGGACGTGGTCCTGGAGCACCTGCCCGAGAGCGTGCTCAGAGACGTGGTCCGCATCTCCCGCTGGCTGGTGGAATATGGTCGGAACCAAG ACTTCA

TGAATGTCTACTACCAGATCCGCTCCAGCCAGCTGGACCGCTCCATCAAGGGTCTGAAGGAGCATTTTCGCAAAAGCAGTTCCTCTTCTGGGGTTCCCTA

CTCCCCCGCCATCCCCAATAAGAG
Translation
MASCFSLPARGCLSKERANQPLATRKDPRMPQ - UNI31736 - EEETLSFIRDSLEKSDQLTRNM VSILSSFESRLMKLENSIIPVHKQTENLQRL

QENVEKTLSCLDHVISYYHVASDTEKIIREG GPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKV KLLFERGKESLESEFRSLMTRHSKVVSPVLL

LDLISADDELEVQEDVVLEHLPESVLRDVVRISRWLVEYGRNQD DFMNVYYQIRSSQLDRSIKGLKEHFRKSSSSSGVPYSPAIPNK
Transcript ENSMUST00000100205
Sequence
GCAGGGTTTGGAGCTAAAACAGCGGGGAGTGGGGACAGCGCTGTCCGCTGCTATGATTCCCCCGCAGGAGGCTTCCGCCCGGCGGCGGGAGATCGAGGAC

AAACTGAAGCAG - UNI31736 - GTGTCCATCCTGTCGTCCTTTGAGAGCCGACTCATGAAGCTGGAGAACTCTATCATCCCTGTGCACAAGCAGAC

AGAGAACCTACAGAGGCTGCAGGAGAACGTGGAGAAGACGTTATCCTGCCTGGACCACGTTATCAGCTACTACCACGTAGCCAGCGACACGGAGAAGATC

ATCCGAGAGGG CCCCACAGGTAGGCTGGAAGAGTACCTGGGAAGTATGGCCAAAATCCAGAAGGCTGTGGAGTATTTTCAGGACAATAGCCCAGACAGC

CCAGAACTCAACAAAGTG AAGCTGCTGTTTGAGCGAGGGAAGGAGTCCCTGGAGTCGGAGTTCCGCAGTCTGATGACCCGGCACAGCAAGGTGGTCTCC

CCCGTGCTCCTCCTGGACCTCATCAGTGCTGACGACGAGCTGGAGGTGCAGGAGGACGTGGTCCTGGAGCACCTGCCCGAGAGCGTGCTCAGAGACGTGG

TCCGCATCTCCCGCTGGCTGGTGGAATATGGTCGGAACCAAG ACTTCATGAATGTCTACTACCAGATCCGCTCCAGCCAGCTGGACCGCTCCATCAAGG

GTCTGAAGGAGCATTTTCGCAAAAGCAGTTCCTCTTCTGGGGTTCCCTACTCCCCCGCCATCCCCAATAAGAGGAAAGACACGCCCACCAAGAAGCCCAT

CAAGCGGCCAG GGAGAGACGACATGCTGGACGTGGAGACGGACGCCTACATTCACTGCGTCAGTGCCTTCGTCAAGCTGGCGCAGAGTGAATACCGGCT

GCTGATGGAGATCATCCCTGAGCATCACCAGAAGAAAACCTTTGACTCCTTGATACAG GATGCCCTGGACGGGCTGATGCTTGAAGGGGAGAACATCGT

GTCTGCTGCCAGGAAAGCCATCATCCGCCATGACTTCTCCACAGTGCTCACCGTCTTCCCCATCCTGCGGCACCTCAAGCAGACCAAGCCCGAGTTTGAC

CAGGTGCTCCAG GGCACAGCAGCCAGCACCAAGAACAAGCTGCCCGGCCTCATCACCTCCATGGAGACCATTGGGGCCAAAGCTCTAGAAGACTTTGCT

GATAACATCAAG AATGATCCAGACAAGGAATACAACATGCCTAAAGACGGCACTGTTCATGAGCTCACAAGCAAT GCCATCCTGTTCCTACAGCAGCT

TCTGGACTTCCAGGAGACAGCAGGTGCCATGCTGGCCTCCCAAG AAACCAGCTCTTCGGCCACCAGCTACAGCTCCGAGTTCAGCAAGCGGCTGCTGAG

CACCTACATCT GCAAAGTCTTGGGTAACCTGCAGCTGAACTTACTAAGCAAGTCCAAGGTGTACGAGGATCCAGCGCTGAGCGCCATCTTCCTACACAA

CAACTACAATTACATCCTCAAGTCCCTGGAGAA GTCTGAGCTGATCCAGCTGGTGGCTGTAACCCAGAAGACTGCCGAGCGCTCCTACCGGGAGCACAT

CGAGCAGCAGATCCAGACCTACCAGCGCAG CTGGCTAAAGGTGACTGACTACATCGCAGAGAAGAACCTACCTGTGTTCCAGCCTGGAGTCAAG CTCC

GGGACAAAGAGCGGCAGATGATTAAGGAACGTTTCAAG GGGTTCAATGATGGACTCGAAGAGCTGTGCAAGATTCAGAAGGTCTGGGCTATTCCAGACA

CAGAGCAGAGAGACAAGATTCGACAGGCTCAGAAAGACATTGTCAAGGAGACCTACGGGGCCTTTCTGCACAG GTATGGCAGCGTGCCCTTCACCAAAA

ACCCGGAGAAATACATTAAGTACCGCGTGGAGCAGGTGGGAGACATGATCGATCGCCTTTTCGACACCTCTGCTTGAGTCTGCCAGTGTTTCTGCCCAGT

TCTGCCGGCATGCCTAGCATGTCATTGGACTCATAAACCAGTGGTAACTC
Translation
MIPPQEASARRREIEDKLKQ - UNI31736 - VSILSSFESRLMKLENSIIPVHKQTENLQRLQENVEKTLSCLDHVISYYHVASDTEKIIREG GPT

GRLEEYLGSMAKIQKAVEYFQ              

For any suggestions or comments, please send an email to unitrap@crg.es