Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020812 (1810032O08Rik)
Chromosomal location
Chr 11: 116532983 - 116537112 (+)
Description
RIKEN cDNA 1810032O08 gene Gene [Source:MGI Symbol;Acc:MGI:1913543]
UniGene
Mm.340063 Mm.432051 
MGI
MGI:1913543 
Uniprot/SPTREMBL
Q8C2B7 Q9D8U9 
Human Ortholog
not available
Omim not available
UniTrap UNI9840
Vector Insertion
Chr 11: 116532994 - 116533071
Public Clones NPX494 (baygenomics) XB730 (baygenomics) XB200 (baygenomics) XB620 (baygenomics)
XB754 (baygenomics) XB294 (baygenomics) XB675 (baygenomics) XA037 (baygenomics)
D047H02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25583
Vector Insertion
Chr 11: 116533071 - 116533477
Public Clones IST10311E11 (tigm) IST14136B6 (tigm)
Private Clones OST175320 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4924
Vector Insertion
Chr 11: 116533477 - 116533670
Public Clones AL0843 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26364
Vector Insertion
Chr 11: 116533670 - 116533977
Public Clones D047H02 (ggtc) IST14161H9 (tigm)
Private Clones OST123090 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12476
Vector Insertion
Chr 11: 116535386 - 116535613
Public Clones W097D07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3714
Vector Insertion
Chr 11: 116535690 - 116536821
Public Clones XT0178 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106379
Sequence
CTCTGCCGCGTGTTTGGAAGTTATGGCCGCGCGGGTCTGTGGTGTTCTCCCTGAAAGGCCTAAGCTTTGGGTGATG - UNI4924 - - UNI9840 -

 - UNI25583 - - UNI26364 - ACGGAGGTGTTGTCTCCAGGAAGCATCATGGAAAGGCGTGGTGGTGCACAAGGGCCTTCAGGATGCCTGCGCC

TG GTGACGGCTGCGCCTCAGGTTCTGGGCCTGACTCGGAAGGGTGCCTGTGAGCAGAAGAGCTGGCACGCGCAGCTCAGTGGACCATCAGTGCCAACCC

GTCCTGTACCCTGGCTGAGGGGTGTGCTAAGTGGCAG - UNI12476 - ATTCCCGGTTGGCTCATCGTAAGGCGTGGCACAAAATCACCATCGAAAG

AAAGGGCCTTCGGGATGCCTCTATCTG - UNI3714 - GTTATTGCCCTGTAGTGCCAGAGAGAACCACATAGCCTGCTGCTGCTCCTGCCTTTAATT

TCCCAAAGAGTCATCAGACGACCTTGGAGTTTGTTCTGCAAGAGGAGCCAGTAAGGCCTCGTGACTGTGGTCACCCTCGGAAGCCTTTGACAGCTAGCTG

GTGAGGGCGCTCAGTCGGAGGCCCTGGGGAGGCCCCTGCTAAGCCGAGAAAAGCATTTCTCACAGTGGATTTCCTGGAAGTCAGGGTTGGCCTTTGTATT

TTGAAGCACAAATAAACTTTATAAAATTT
Translation
MAARVCGVLPERPKLWVM - UNI4924 - - UNI9840 - - UNI25583 - - UNI26364 - TEVLSPGSIMERRGGAQGPSGCLRL VTAAP

QVLGLTRKGACEQKSWHAQLSGPSVPTRPVPWLRGVLSGR - UNI12476 - RFPVGSS - UNI3714 - 
Transcript ENSMUST00000021167
Sequence
CTCTGCCGCGTGTTTGGAAGTTATGGCCGCGCGGGTCTGTGGTGTTCTCCCTGAAAGGCCTAAGCTTTGGGTGATG - UNI4924 - - UNI9840 -

 - UNI25583 - GCATTGCCTTTTGGCACTCGGGAGACAAGATGCAGGTTCCGTCTCAGAAGTAATGGCTGGATCCCTGAAAGCCAACGGGCTCGGTG

TGGTCCACCCGTCAGAAGGCATAGGTAGATGGTGGGCATCTGCCTCAGACATAGTTCTCAAGTTCAGCCAGAAGAATGCGCGTTGAGCCCTCTGCAGCCC

GTGTCG - UNI4924 - - UNI26364 - ACGGAGGTGTTGTCTCCAGGAAGCATCATGGAAAGGCGTGGTGGTGCACAAGGGCCTTCAGGATGCCT

GCGCCTG GTGACGGCTGCGCCTCAGGTTCTGGGCCTGACTCGGAAGGGTGCCTGTGAGCAGAAGAGCTGGCACGCGCAGCTCAGTGGACCATCAGTGCC

AACCCGTCCTGTACCCTGGCTGAGGGGTGTGCTAAGTGGCAG - UNI12476 - ATTCCCGGTTGGCTCATCGTAAGGCGTGGCACAAAATCACCATC

GAAAGAAAGGGCCTTCGGGATGCCTCTATCTG - UNI3714 - GTTATTGCCCTGTAGTGCCAGAGAGAACCACATAGCCTGCTGCTGCTCCTGCCTT

TAATTTCCCAAAGAGTCATCAGACGACCTTGGAGTTTGTTCTGCAAGAGGAGCCAGTAAGGCCTCGTGACTGTGGTCACCCTCGGAAGCCTTTGACAGCT

AGCTGGTGAGGGCGCTCAGTCGGAGGCCCTGGGGAGGCCCCTGCTAAGCCGAGAAAAGCATTTCTCACAGTGGATTTCCTGGAAGTCAGGGTTGGCCTTT

GTATTTTGAAGCACAAATAAACTTTATAAAATTT
Translation
 - UNI4924 - - UNI9840 - - UNI25583 - MVGICLRHSSQVQPEECALSPLQPVS - UNI4924 - - UNI26364 - TEVLSPGSIM

ERRGGAQGPSGCLRL VTAAPQVLGLTRKGACEQKSWHAQLSGPSVPTRPVPWLRGVLSGR - UNI12476 - RFPVGSS - UNI3714 - 
Transcript ENSMUST00000106378
Sequence
CTTTCCGAGGTCCTCTGCCGCGTGTTTGGAAGTTATGGCCGCGCGGGTCTGTGGTGTTCTCCCTGAAAGGCCTAAGCTTTGGGTGATG - UNI4924 -

 - UNI9840 - - UNI25583 - GCATTGCCTTTTGGCACTCGGGAGACAAGATGCAGGTTCCGTCTCAGAAGTAATGGCTGGATCCCTGAAAGCCA

ACGGGCTCGGTGTGGTCCACCCGTCAGAAGGCATAGGTAGATGGTGGGCATCTGCCTCAGACATAGTTCTCAAGTTCAGCCAGAAGAATGCGCGTTGAGC

CCTCTGCAGCCCGTGTCG - UNI4924 - - UNI26364 - ACGGAGGTGTTGTCTCCAGGAAGCATCATGGAAAGGCGTGGTGGTGCACAAGGGCC

TTCAGGATGCCTGCGCCTG GTGACGGCTGCGCCTCAGGTTCTGGGCCTGACTCGGAAGGGTGCCTGTGAGCAGAAGAGCTGGCACGCGCAGCTCAGTGG

ACCATCAGTGCCAACCCGTCCTGTACCCTGGCTGAGGGGTGTGCTAAGTGGCAG - UNI12476 - ATTCCCGGTTGGCTCATCGTAAGGCGTGGCAC

AAAATCACCATCGAAAGAAAGGGCCTTCGGGATGCCTCTATCTGGTAAGAGCTTCACAGAATTGCAGGGGTTGTGGTTGCTGGGAAGGGTTAGTCTGTTA

GATCAGGTGCTGCAGAATCGAGTGTAACCCTTCCTCCCTTTAGTCTTACTGTGTAGCCCGTGCTGGCCTGCAACTTGCTATGTAGACCTGGTTGACCTCA

AACTCAGTTTGTGGCCTTTCAGGTGCTGGGATTTTCATGTTCTCATTTTGTGTTCCCGAAAAGCCCATAAGCCTATGATGGATTGGTTATCCCTGTCTGA

AGATTTCAGCTGAGGGAAAATACTCTATTCTGAGGCTTAGGGGTGTGGCTCCATGCTTGAAGAAATTTGAGCTTTATAAGGGATCAAGTTAAATAGACTC

CATAGAGAGCTGTGTGCCAACCTCCCAAAACCTAAGGTCTAGTTGCCTGTTAATCCTCCTCCTTGGGTGCTCTGAGGGCAAAGTCCCTGAGTTAGCAGAA

ATGGGCGGGCTGCCAGCACCTGTCCTGTGCTCACTGGAGTGAGACATGCTGGTCACATAGTTCTAGAAAATGAATGTCTTCCTTTAGAGGAGGCAGGGAT

GTAAGGCGTGCCATGAGAATGCTTGACGACTCTGTCGTTGCCTCTAGCGGTGCTGACATTTAGAAAAGAAGTTGTGGCCCTGGCAGCCTCCTAAGTATCG

TCTCCTTGATGGCACAGAAACAAGTGGCGGGCTTGGGGGGGGGGGGGCTTTGCTCAGCCCAGCCTTAGTAATGCAGTGTACACTGTGTCCTTTTTCTCTA

TGGAATCTGGGGGGTGGATATGGGCTTACACTAAAGTAGCTGTACTTGTGGAATTCTCTGCAGGGTGGCTCTGCTTGCCTTCACTTCTGAGTGGACTCAG

GTTCAGGTCCTCAGGGATTTGGTTGAATATAAATACTCTGATGTTTCATGAGAAACCTTTTTTTGGCCACTTACCAGGAACTTCTTAAAACTTTCTTTTA

AAAAAAAAGTTAGCAGCCTGCTTCTGAACTTGGCTGGTGCCTGCCTGTGTGTAGCGCACACAGTGCCTTGTGATGGCGGCTGGAATCCCAGGACTATCTG

ATAATGCTTGTTCCTAAAGTTTGTAGTTTTGATCACTTAGCTGCCTGTCTCCTTCAGGTTCTTTCCTTGTTTCTAGGTTATTGCCCTGTAGTGCCAGAGA

GAACCACATAGCCTGCTGCTGCTCCTGCCTTTAATTTCCCAAAGAGTCATCAGACGACCTTGGAGTTTGTTCTGCAAGAGGAGCCAGTAAGGCCTCGTGA

CTGTGGTCACCCTCGGAAGCCTTTGACAGCTAGCTGGTGAGGGCGCTCAGTCGGAGGCCCTGGGGAGGCCCCTGCTAAGCCGAGAAAAGCATTTCTCACA

GTGGATTTCCTGGAAGTCAGGGTTGGCCTTTGTATTTTGAAGCACAAATAAACTTTATAAAATTTAA
Translation
 - UNI4924 - - UNI9840 - - UNI25583 - MVGICLRHSSQVQPEECALSPLQPVS - UNI4924 - - UNI26364 - TEVLSPGSIM

ERRGGAQGPSGCLRL VTAAPQVLGLTRKGACEQKSWHAQLSGPSVPTRPVPWLRGVLSGR - UNI12476 - RFPVGSS

For any suggestions or comments, please send an email to unitrap@crg.es