Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020817 (Rabep1)
Chromosomal location
Chr 11: 70658265 - 70754805 (+)
Description
rabaptin, RAB GTPase binding effector protein 1 Gene [Source:MGI (curated);Acc:Rabep1-002]
RefSeq_dna
NM_019400 
RefSeq_peptide
NP_062273.1 
UniGene
Mm.7087 
MGI
MGI:1860236 
Uniprot/SWISSPROT
O35551 
Uniprot/SPTREMBL
Q5QNU3 Q5QNU4 Q5QNU2 
Human Ortholog
ENSG00000029725 (RABEP1)
Omim not available
UniTrap UNI5651
Vector Insertion
Chr 11: 70658511 - 70688247
Public Clones CSD232 (baygenomics) XE223 (baygenomics) XH029 (baygenomics) CSI529 (baygenomics)
XE347 (baygenomics) (egtc) IST12251E3 (tigm) IST11174E10 (tigm) IST13697A11 (tigm)
IST12877A8 (tigm) IST10442F3 (tigm) IST14180B8 (tigm) IST12647E3 (tigm)
IST14462A5 (tigm) IST14291E2 (tigm) IST10339H4 (tigm) IST10055F11 (tigm)
IST11350A10HMF1 (tigm) IST11300H6 (tigm) IST11080B8 (tigm) IST12270H1 (tigm)
IST12724E9 (tigm)
Private Clones OST423035 (lexicon) OST422681 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36146
Vector Insertion
Chr 11: 70688377 - 70698266
Public Clones IST10408E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4121
Vector Insertion
Chr 11: 70700674 - 70707070
Public Clones AN0575 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7418
Vector Insertion
Chr 11: 70707194 - 70713973
Public Clones RRS672 (baygenomics) IST13577F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4291
Vector Insertion
Chr 11: 70736744 - 70739273
Public Clones AH0003 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7603
Vector Insertion
Chr 11: 70739415 - 70747906
Public Clones RRF175 (baygenomics) RRR449 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7369
Vector Insertion
Chr 11: 70748622 - 70748685
Public Clones RRS455 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100928
Sequence
ATTTCCCGCTGTCAGGATGAGGAGGCGGAGGTCGGCGCTCCGGTCCGTCTCTGCCCGAGGCTGTGGCGGCGCCGGCGGCTCCAGCCTTAGCGGTTCCTCC

CTGGGCGGCGGTGGCCGCGGCTCGGTCGACGCCTCCTCCGCCAGCTGAGCCCGCGGCATCCCGGGACGCCGCTTCCCCGCCCATCCCCGTTCTCCGAGGC

CGCCCACTGGCCATGGCGCAGCCGGGCCCGGCTCCCCAGCCTGACG - UNI5651 - TTTCTCTTCAGCAACGGGTAGCAGAATTGGAAAAAATTAAT

GCAGAATTTTTACGTGCACAGCAGCAGCTTGAGCAAGAATTTAATCAAAAGAGAGCAAAATTTAAGGAGCTCTATTTGGCTAAAGAGG AGGATCTGAAG

AGGCAAAATGCAGTATTGCAAGCTGCACAGGACGATTTGGGTCACCTTCGGACACAGCTGTGGGAGGCTCAGGCAGAGATGGAGAACATTAAGGCAATTG

CCACAGTCTCTGAGAATACTAAGCAAGAAGCTATAGATGAAGTTAAAAGGCAATGGAGAGAAGAAGTTGCTTCACTTCAGGCTATAATGAAAG AGACAG

TCCGTGACTATGAGCATCAGTTTCACCTGAGGCTGGAGCAGGAGCGAGCACAGTGGGCACAGTATCGAGAATCTGCAGAGCGGGAAATAGCTGACTTAAG

AAGAAGGTTGTCTGAAGGTCAAGAGGAAGAAAATTTAGAAAATGAAATGAAAAAG - UNI4121 - GCCCAAGAGGATGCTGAAAAGCTTCGTTCTGT

CGTGATGCCCATGGAGAAGGAAATTGCAGCTCTGAAAGATAAACTGACAGAAGCTGAAGACAAGATTAAAGAGCTGGAGGCCTCAAAG - UNI7418 -

 GTTAAGGAGCTGAATCATTATCTGGAGGCCGAGAAGTCTTGCAGGACTGACCTGGAGATGTACGTAGCTGTTTTGAACACTCAGAAATCTGTGCTACAG

GAAGATGCTGAGAAATTGAGGAAAGAACTGCATGAAG TTTGCCATCTCTTGGAACAAGAACGACAACAACACAACCAGTTAAAGCATACATGGCAGAAG

GCCAACGACCAGTTTCTGGAATCTCAGCGTTTGCTGATGAGAGACATGCAGAGAATGGAGATTGTGTTAACTTCGGAACAGCTCCGACAAGTTGAAGAAC

TAAAGAAGAAAGACCAG GAGGAGGATGAACAACAAAGGGTCAATAAGAGAAAAGATAACAAGAAAACAGATACCGAAGAAGAAGTAAAAATACCAGTAG

TGTGTGCTTTAACTCAAGAAGAATCTTCAACCCCATTATCAAATGAAGAG GAGCATTTAGACAGCACCCATGGGTCAGTCCATTCCTTGGATGCAGACT

TGATGTTACCATCTGGAGATCCATTTAGTAAATCGGACAATGACATGTTTAAAGATGGACTCAGGAGAGCTCAGTCTACAGACAGCTTGGGAACCTCAAG

CTCATTGCAATCCAAAGCTTTAGGCTATAACTACAAAGCGAAATCTGCTGGAAATTTGGATGAGTCGGATTTTGGACCACTGGTTGGAGCAGATTCTGTG

TCTGAGAACTTTGATACTGTGTCCCTTGGGTCACTGCAGATGCCAAGTGGATTTATGTTAACCAAAGATCAAGAAAGAGCAATTAAGGCAATGACACCTG

AGCAGGAGGAGACAGCATCCCTCCTCTCCAGTGTCACCCAGGGTATGGAGAGTGCATATGTATCTCCCAGTGGTTACCGCTTAGTGAGTGAGACGGAATG

GAATCTCCTGCAGAAAGAG GTACATAATGCTGGAAATAAGCTTGGTAGACGTTGTGATATGTGTTCCAATTATGAAAAACAGTTACAAGGAATTCAGAT

TCAGGAAGCTGAAACAAGAGACCAG GTGAAAAAACTGCAGTTAATGCTCAGGCAAGCTAATGACCAGCTTGAGAAGACGATGAAAGAGAAGCAGGAGCT

GGAGGACTTCCTCAAGCAGAGTGCGGAGGACTCAAGCCACCAG ATATCTGCACTTGTTTTAAGAGCCCAAGCCTCTGAGGTCTTACTTGAAGAGTTACA

ACAGAGCTTTTCCCAAGCAAAGAGGGACGTTCAGGAGCAGATG - UNI4291 - GCGGTGCTGATGCAGTCACGTGAACAGGTTTCAGAAGAGTTGGT

GAGGTTACAGAAAGACAACGACAGCCTCCAGGGGAAGCACAGCTTGCATGTGTCATTACAGCTAGCAGAAGACTTCATTCTTCCAGACACTGTGGAG - 

UNI7603 - GTGCTCCGGGAACTGGTTTTAAAATATCGTGAGAACATTGTTCATGTGCGCACAGCAGCAGACCACATGGAAGAGAAGCTGAAGGCGGAA

ATACTTTTCCTAAAAGAGCAAATTCAAGCGGAACAGTGTTTAAAAGAAAACCTGGAAGAGACACTACAGCTGGAAATAGAAAACTGCAAGGAGGAAATAG

 - UNI7369 - TCCTAGCTTCCATTTCTAGTCTAAAAGCTGAATTAGAAAGAATAAAGGTTGAAAAGGGACAG - UNI7369 - TTGGAATCTACA

TTAAGAGAGAAGTCGCAACAACTTGAGAGTCTCCAAGAAATGAAAGTTAATTTAGAGGAACAGTTAAAGAAAGAAACTGCTGCTAAG GCTACTGTTGAA

CAGCTCATGTTTGAAGAGAAGAACAAAGCTCAGAGGTTGCAGACAGAATTAGATGTCAGTGAACAAGTACAGAGAGATTTTGTAAAACTTTCTCAGACTC

TTCAG GTGCAGTTGGAGAGGATCCGGCAAGCAGACTCCTTGGAGAGGATCCGGGCTATTCTGAATGATACCAAACTGACAGACATTAACCAGCTCCCTG

AGACATGACACCCTGATAGCAGGATTCTAACCTGCATTTTGGGTTTTTAACTCATCTTTAGAATATTTATTATTATTTAACTCTTAACGGAAGAAGTCAC

AGCAAAGGAAGACTGAAGAAATGCAAATCTGGAGGGAGAAGGCTGCTGTGTGCAGGGACAGCCAACACCTTTCAAAGGGAACACTAATAAGACACTGGAC

TCGATTCCAACAGGTGTGGGATCAGATGAGGTGCCAGAAAAGTTGCTGTTTCCTGCCTGCTTTCTCCAACATGGATTTTGGAACATATTTCCTGACATGA

AAGCAACTTCCCAATAGTGTTTGGAATTACGTTTTCTGTTCATACAAACCGGGAGAGAGAAGTTTCTTTTTTCAGTTGTCTAAGGCTTCATCAGTAGCAG

TGTTCAGCTAGCAGAGAGGTGTAGTGTGCTATATGAGTATTTTATATTAAAATATGAAGTGTGAGAGCAGGCCATTGGCTGTTGATTGTATTTCCCTTGC

TCAGTGCATTTTGTTTCCTTTTTACCATTTTATCTTCTATTGGAAGACCTTAAATGCTACTGAAACTTGCCTGAGAACTATAGGACCATGGCAAGCAAAA

ACAATTAAACAAAATTAGAATCTGAATATTTGGCTGAGGCCATATATTGGAAGTTGAATTTATGGAAAAAAGCACAAACAACCTTGGAAGCACTTTGCAC

ACCGTGATGAACTTCCTGGGCCCAAAGGTACCAGGGCAAATAACTGGCACCATCTACCCTTTCCAAGTGTTTAGTTACTGGATCAGTGGTGAGAATAATA

TTAATAAAACAAGCTATCTCTGACATCT
Translation
MAQPGPAPQPDV - UNI5651 - VSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEE EDLKRQNAVLQAAQDDLGHLRTQLWEAQAE

MENIKAIATVSENTKQEAIDEVKRQWREEVASLQAIMKE ETVRDYEHQFHLRLEQERAQWAQYRESAEREIADLRRRLSEGQEEENLENEMKK - UNI

4121 - AQEDAEKLRSVVMPMEKEIAALKDKLTEAEDKIKELEASK - UNI7418 - VKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLR

KELHEV VCHLLEQERQQHNQLKHTWQKANDQFLESQRLLMRDMQRMEIVLTSEQLRQVEELKKKDQ EEDEQQRVNKRKDNKKTDTEEEVKIPVVCALT

QEESSTPLSNEE EHLDSTHGSVHSLDADLMLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSSSLQSKALGYNYKAKSAGNLDESDFGPLVGADSVSENF

DTVSLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKE VHNAGNKLGRRCDMCSNYEKQLQGIQIQEA

ETRDQ VKKLQLMLRQANDQLEKTMKEKQELEDFLKQSAEDSSHQ ISALVLRAQASEVLLEELQQSFSQAKRDVQEQM - UNI4291 - AVLMQSRE

QVSEELVRLQKDNDSLQGKHSLHVSLQLAEDFILPDTVE - UNI7603 - VLRELVLKYRENIVHVRTAADHMEEKLKAEILFLKEQIQAEQCLKENL

EETLQLEIENCKEEIV - UNI7369 - VLASISSLKAELERIKVEKGQ - UNI7369 - LESTLREKSQQLESLQEMKVNLEEQLKKETAAK ATV

EQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQ VQLERIRQADSLERIRAILNDTKLTDINQLPET
Transcript ENSMUST00000076270
Sequence
ATTTCCCGCTGTCAGGATGAGGAGGCGGAGGTCGGCGCTCCGGTCCGTCTCTGCCCGAGGCTGTGGCGGCGCCGGCGGCTCCAGCCTTAGCGGTTCCTCC

CTGGGCGGCGGTGGCCGCGGCTCGGTCGACGCCTCCTCCGCCAGCTGAGCCCGCGGCATCCCGGGACGCCGCTTCCCCGCCCATCCCCGTTCTCCGAGGC

CGCCCACTGGCCATGGCGCAGCCGGGCCCGGCTCCCCAGCCTGACG - UNI5651 - TTTCTCTTCAGCAACGGGTAGCAGAATTGGAAAAAATTAAT

GCAGAATTTTTACGTGCACAGCAGCAGCTTGAGCAAGAATTTAATCAAAAGAGAGCAAAATTTAAGGAGCTCTATTTGGCTAAAGAGG AGGATCTGAAG

AGGCAAAATGCAGTATTGCAAGCTGCACAGGACGATTTGGGTCACCTTCGGACACAGCTGTGGGAGGCTCAGGCAGAGATGGAGAACATTAAGGCAATTG

CCACAGTCTCTGAGAATACTAAGCAAGAAGCTATAGATGAAGTTAAAAGGCAATGGAGAGAAGAAGTTGCTTCACTTCAGGCTATAATGAAAG AGACAG

TCCGTGACTATGAGCATCAGTTTCACCTGAGGCTGGAGCAGGAGCGAGCACAGTGGGCACAGTATCGAGAATCTGCAGAGCGGGAAATAGCTGACTTAAG

AAGAAGGTTGTCTGAAGGTCAAGAGGAAGAAAATTTAGAAAATGAAATGAAAAAG - UNI4121 - GCCCAAGAGGATGCTGAAAAGCTTCGTTCTGT

CGTGATGCCCATGGAGAAGGAAATTGCAGCTCTGAAAGATAAACTGACAGAAGCTGAAGACAAGATTAAAGAGCTGGAGGCCTCAAAG - UNI7418 -

 GTTAAGGAGCTGAATCATTATCTGGAGGCCGAGAAGTCTTGCAGGACTGACCTGGAGATGTACGTAGCTGTTTTGAACACTCAGAAATCTGTGCTACAG

GAAGATGCTGAGAAATTGAGGAAAGAACTGCATGAAG TTTGCCATCTCTTGGAACAAGAACGACAACAACACAACCAGTTAAAGCATACATGGCAGAAG

GCCAACGACCAGTTTCTGGAATCTCAGCGTTTGCTGATGAGAGACATGCAGAGAATGGAGATTGTGTTAACTTCGGAACAGCTCCGACAAGTTGAAGAAC

TAAAGAAGAAAGACCAG GAGGAGGATGAACAACAAAGGGTCAATAAGAGAAAAGATAACAAGAAAACAGATACCGAAGAAGAAGTAAAAATACCAGTAG

TGTGTGCTTTAACTCAAGAAGAATCTTCAACCCCATTATCAAATGAAGAG GAGCATTTAGACAGCACCCATGGGTCAGTCCATTCCTTGGATGCAGACT

TGATGTTACCATCTGGAGATCCATTTAGTAAATCGGACAATGACATGTTTAAAGATGGACTCAGGAGAGCTCAGTCTACAGACAGCTTGGGAACCTCAAG

CTCATTGCAATCCAAAGCTTTAGGCTATAACTACAAAGCGAAATCTGCTGGAAATTTGGATGAGTCGGATTTTGGACCACTGGTTGGAGCAGATTCTGTG

TCTGAGAACTTTGATACTGTGTCCCTTGGGTCACTGCAGATGCCAAGTGGATTTATGTTAACCAAAGATCAAGAAAGAGCAATTAAGGCAATGACACCTG

AGCAGGAGGAGACAGCATCCCTCCTCTCCAGTGTCACCCAGGGTATGGAGAGTGCATATGTATCTCCCAGTGGTTACCGCTTAGTGAGTGAGACGGAATG

GAATCTCCTGCAGAAAGAG GTACATAATGCTGGAAATAAGCTTGGTAGACGTTGTGATATGTGTTCCAATTATGAAAAACAGTTACAAGGAATTCAGAT

TCAGGAAGCTGAAACAAGAGACCAG GTGAAAAAACTGCAGTTAATGCTCAGGCAAGCTAATGACCAGCTTGAGAAGACGATGAAAGAGAAGCAGGAGCT

GGAGGACTTCCTCAAGCAGAGTGCGGAGGACTCAAGCCACCAG ATATCTGCACTTGTTTTAAGAGCCCAAGCCTCTGAGGTCTTACTTGAAGAGTTACA

ACAGAGCTTTTCCCAAGCAAAGAGGGACGTTCAGGAGCAGATG - UNI4291 - GCGGTGCTGATGCAGTCACGTGAACAGGTTTCAGAAGAGTTGGT

GAGGTTACAGAAAGACAACGACAGCCTCCAGGGGAAGCACAGCTTGCATGTGTCATTACAGCTAGCAGAAGACTTCATTCTTCCAGACACTGTGGAG - 

UNI7603 - GTGCTCCGGGAACTGGTTTTAAAATATCGTGAGAACATTGTTCATGTGCGCACAGCAGCAGACCACATGGAAGAGAAGCTGAAGGCGGAA

ATACTTTTCCTAAAAGAGCAAATTCAAGCGGAACAGTGTTTAAAAGAAAACCTGGAAGAGACACTACAGCTGGAAATAGAAAACTGCAAGGAGGAAATAG

 - UNI7369 - CTTCCATTTCTAGTCTAAAAGCTGAATTAGAAAGAATAAAGGTTGAAAAGGGACAG - UNI7369 - TTGGAATCTACATTAAGA

GAGAAGTCGCAACAACTTGAGAGTCTCCAAGAAATGAAAGTTAATTTAGAGGAACAGTTAAAGAAAGAAACTGCTGCTAAG GCTACTGTTGAACAGCTC

ATGTTTGAAGAGAAGAACAAAGCTCAGAGGTTGCAGACAGAATTAGATGTCAGTGAACAAGTACAGAGAGATTTTGTAAAACTTTCTCAGACTCTTCAG 

GTGCAGTTGGAGAGGATCCGGCAAGCAGACTCCTTGGAGAGGATCCGGGCTATTCTGAATGATACCAAACTGACAGACATTAACCAGCTCCCTGAGACAT

GACACCCTGATAGCAGGATTCTAACCTGCATTTTGGGTTTTTAACTCATCTTTAGAATATTTATTATTATTTAACTCTTAACGGAAGAAGTCACAGCAAA

GGAAGACTGAAGAAATGCAAATCTGGAGGGAGAAGGCTGCTGTGTGCAGGGACAGCCAACACCTTTCAAAGGGAACACTAATAAGACACTGGACTCGATT

CCAACAGGTGTGGGATCAGATGAGGTGCCAGAAAAGTTGCTGTTTCCTGCCTGCTTTCTCCAACATGGATTTTGGAACATATTTCCTGACATGAAAGCAA

CTTCCCAATAGTGTTTGGAATTACGTTTTCTGTTCATACAAACCGGGAGAGAGAAGTTTCTTTTTTCAGTTGTCTAAGGCTTCATCAGTAGCAGTGTTCA

GCTAGCAGAGAGGTGTAGTGTGCTATATGAGTATTTTATATTAAAATATGAAGTGTGAGAGCAGGCCATTGGCTGTTGATTGTATTTCCCTTGCTCAGTG

CATTTTGTTTCCTTTTTACCATTTTATCTTCTATTGGAAGACCTTAAATGCTACTGAAACTTGCCTGAGAACTATAGGACCATGGCAAGCAAAAACAATT

AAACAAAATTAGAATCTGAATATTTGGCTGAGGCCATATATTGGAAGTTGAATTTATGGAAAAAAGCACAAACAACCTTGGAAGCACTTTGCACACCGTG

ATGAACTTCCTGGGCCCAAAGGTACCAGGGCAAATAACTGGCACCATCTACCCTTTCCAAGTGTTTAGTTACTGGATCAGTGGTGAGAATAATATTAATA

AAACAAGCTATCTCTGACATCT
Translation
MAQPGPAPQPDV - UNI5651 - VSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEE EDLKRQNAVLQAAQDDLGHLRTQLWEAQAE

MENIKAIATVSENTKQEAIDEVKRQWREEVASLQAIMKE ETVRDYEHQFHLRLEQERAQWAQYRESAEREIADLRRRLSEGQEEENLENEMKK - UNI

4121 - AQEDAEKLRSVVMPMEKEIAALKDKLTEAEDKIKELEASK - UNI7418 - VKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLR

KELHEV VCHLLEQERQQHNQLKHTWQKANDQFLESQRLLMRDMQRMEIVLTSEQLRQVEELKKKDQ EEDEQQRVNKRKDNKKTDTEEEVKIPVVCALT

QEESSTPLSNEE EHLDSTHGSVHSLDADLMLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSSSLQSKALGYNYKAKSAGNLDESDFGPLVGADSVSENF

DTVSLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKE VHNAGNKLGRRCDMCSNYEKQLQGIQIQEA

ETRDQ VKKLQLMLRQANDQLEKTMKEKQELEDFLKQSAEDSSHQ ISALVLRAQASEVLLEELQQSFSQAKRDVQEQM - UNI4291 - AVLMQSRE

QVSEELVRLQKDNDSLQGKHSLHVSLQLAEDFILPDTVE - UNI7603 - VLRELVLKYRENIVHVRTAADHMEEKLKAEILFLKEQIQAEQCLKENL

EETLQLEIENCKEEIA - UNI7369 - ASISSLKAELERIKVEKGQ - UNI7369 - LESTLREKSQQLESLQEMKVNLEEQLKKETAAK ATVEQ

LMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQ VQLERIRQADSLERIRAILNDTKLTDINQLPET
Transcript ENSMUST00000081362
Sequence
ATTTCCCGCTGTCAGGATGAGGAGGCGGAGGTCGGCGCTCCGGTCCGTCTCTGCCCGAGGCTGTGGCGGCGCCGGCGGCTCCAGCCTTAGCGGTTCCTCC

CTGGGCGGCGGTGGCCGCGGCTCGGTCGACGCCTCCTCCGCCAGCTGAGCCCGCGGCATCCCGGGACGCCGCTTCCCCGCCCATCCCCGTTCTCCGAGGC

CGCCCACTGGCCATGGCGCAGCCGGGCCCGGCTCCCCAGCCTGACG - UNI5651 - TTTCTCTTCAGCAACGGGTAGCAGAATTGGAAAAAATTAAT

GCAGAATTTTTACGTGCACAGCAGCAGCTTGAGCAAGAATTTAATCAAAAGAGAGCAAAATTTAAGGAGCTCTATTTGGCTAAAGAGG AGGATCTGAAG

AGGCAAAATGCAGTATTGCAAGCTGCACAGGACGATTTGGGTCACCTTCGGACACAGCTGTGGGAGGCTCAGGCAGAGATGGAGAACATTAAGGCAATTG

CCACAGTCTCTGAGAATACTAAGCAAGAAGCTATAGATGAAGTTAAAAGGCAATGGAGAGAAGAAGTTGCTTCACTTCAGGCTATAATGAAAG AGACAG

TCCGTGACTATGAGCATCAGTTTCACCTGAGGCTGGAGCAGGAGCGAGCACAGTGGGCACAGTATCGAGAATCTGCAGAGCGGGAAATAGCTGACTTAAG

AAGAAGGTTGTCTGAAGGTCAAGAGGAAGAAAATTTAGAAAATGAAATGAAAAAG - UNI4121 - - UNI7418 - GTTAAGGAGCTGAATCATTA

TCTGGAGGCCGAGAAGTCTTGCAGGACTGACCTGGAGATGTACGTAGCTGTTTTGAACACTCAGAAATCTGTGCTACAGGAAGATGCTGAGAAATTGAGG

AAAGAACTGCATGAAG TTTGCCATCTCTTGGAACAAGAACGACAACAACACAACCAGTTAAAGCATACATGGCAGAAGGCCAACGACCAGTTTCTGGAA

TCTCAGCGTTTGCTGATGAGAGACATGCAGAGAATGGAGATTGTGTTAACTTCGGAACAGCTCCGACAAGTTGAAGAACTAAAGAAGAAAGACCAG GAG

GAGGATGAACAACAAAGGGTCAATAAGAGAAAAGATAACAAGAAAACAGATACCGAAGAAGAAGTAAAAATACCAGTAGTGTGTGCTTTAACTCAAGAAG

AATCTTCAACCCCATTATCAAATGAAGAG GAGCATTTAGACAGCACCCATGGGTCAGTCCATTCCTTGGATGCAGACTTGATGTTACCATCTGGAGATC

CATTTAGTAAATCGGACAATGACATGTTTAAAGATGGACTCAGGAGAGCTCAGTCTACAGACAGCTTGGGAACCTCAAGCTCATTGCAATCCAAAGCTTT

AGGCTATAACTACAAAGCGAAATCTGCTGGAAATTTGGATGAGTCGGATTTTGGACCACTGGTTGGAGCAGATTCTGTGTCTGAGAACTTTGATACTGTG

TCCCTTGGGTCACTGCAGATGCCAAGTGGATTTATGTTAACCAAAGATCAAGAAAGAGCAATTAAGGCAATGACACCTGAGCAGGAGGAGACAGCATCCC

TCCTCTCCAGTGTCACCCAGGGTATGGAGAGTGCATATGTATCTCCCAGTGGTTACCGCTTAGTGAGTGAGACGGAATGGAATCTCCTGCAGAAAGAG G

TACATAATGCTGGAAATAAGCTTGGTAGACGTTGTGATATGTGTTCCAATTATGAAAAACAGTTACAAGGAATTCAGATTCAGGAAGCTGAAACAAGAGA

CCAG GTGAAAAAACTGCAGTTAATGCTCAGGCAAGCTAATGACCAGCTTGAGAAGACGATGAAAGAGAAGCAGGAGCTGGAGGACTTCCTCAAGCAGAG

TGCGGAGGACTCAAGCCACCAG ATATCTGCACTTGTTTTAAGAGCCCAAGCCTCTGAGGTCTTACTTGAAGAGTTACAACAGAGCTTTTCCCAAGCAAA

GAGGGACGTTCAGGAGCAGATG - UNI4291 - GCGGTGCTGATGCAGTCACGTGAACAGGTTTCAGAAGAGTTGGTGAGGTTACAGAAAGACAACGA

CAGCCTCCAGGGGAAGCACAGCTTGCATGTGTCATTACAGCTAGCAGAAGACTTCATTCTTCCAGACACTGTGGAG - UNI7603 - GTGCTCCGGGA

ACTGGTTTTAAAATATCGTGAGAACATTGTTCATGTGCGCACAGCAGCAGACCACATGGAAGAGAAGCTGAAGGCGGAAATACTTTTCCTAAAAGAGCAA

ATTCAAGCGGAACAGTGTTTAAAAGAAAACCTGGAAGAGACACTACAGCTGGAAATAGAAAACTGCAAGGAGGAAATAG - UNI7369 - CTTCCATT

TCTAGTCTAAAAGCTGAATTAGAAAGAATAAAGGTTGAAAAGGGACAG - UNI7369 - TTGGAATCTACATTAAGAGAGAAGTCGCAACAACTTGAG

AGTCTCCAAGAAATGAAAGTTAATTTAGAGGAACAGTTAAAGAAAGAAACTGCTGCTAAG GCTACTGTTGAACAGCTCATGTTTGAAGAGAAGAACAAA

GCTCAGAGGTTGCAGACAGAATTAGATGTCAGTGAACAAGTACAGAGAGATTTTGTAAAACTTTCTCAGACTCTTCAG GTGCAGTTGGAGAGGATCCGG

CAAGCAGACTCCTTGGAGAGGATCCGGGCTATTCTGAATGATACCAAACTGACAGACATTAACCAGCTCCCTGAGACATGACACCCTGATAGCAGGATTC

TAACCTGCATTTTGGGTTTTTAACTCATCTTTAGAATATTTATTATTATTTAACTCTTAACGGAAGAAGTCACAGCAAAGGAAGACTGAAGAAATGCAAA

TCTGGAGGGAGAAGGCTGCTGTGTGCAGGGACAGCCAACACCTTTCAAAGGGAACACTAATAAGACACTGGACTCGATTCCAACAGGTGTGGGATCAGAT

GAGGTGCCAGAAAAGTTGCTGTTTCCTGCCTGCTTTCTCCAACATGGATTTTGGAACATATTTCCTGACATGAAAGCAACTTCCCAATAGTGTTTGGAAT

TACGTTTTCTGTTCATACAAACCGGGAGAGAGAAGTTTCTTTTTTCAGTTGTCTAAGGCTTCATCAGTAGCAGTGTTCAGCTAGCAGAGAGGTGTAGTGT

GCTATATGAGTATTTTATATTAAAATATGAAGTGTGAGAGCAGGCCATTGGCTGTTGATTGTATTTCCCTTGCTCAGTGCATTTTGTTTCCTTTTTACCA

TTTTATCTTCTATTGGAAGACCTTAAATGCTACTGAAACTTGCCTGAGAACTATAGGACCATGGCAAGCAAAAACAATTAAACAAAATTAGAATCTGAAT

ATTTGGCTGAGGCCATATATTGGAAGTTGAATTTATGGAAAAAAGCACAAACAACCTTGGAAGCACTTTGCACACCGTGATGAACTTCCTGGGCCCAAAG

GTACCAGGGCAAATAACTGGCACCATCTACCCTTTCCAAGTGTTTAGTTACTGGATCAGTGGTGAGAATAATATTAATAAAACAAGCTATCTCTGACATC

T
Translation
MAQPGPAPQPDV - UNI5651 - VSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEE EDLKRQNAVLQAAQDDLGHLRTQLWEAQAE

MENIKAIATVSENTKQEAIDEVKRQWREEVASLQAIMKE ETVRDYEHQFHLRLEQERAQWAQYRESAEREIADLRRRLSEGQEEENLENEMKK - UNI

4121 - - UNI7418 - VKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLRKELHEV VCHLLEQERQQHNQLKHTWQKANDQFLESQRLLM

RDMQRMEIVLTSEQLRQVEELKKKDQ EEDEQQRVNKRKDNKKTDTEEEVKIPVVCALTQEESSTPLSNEE EHLDSTHGSVHSLDADLMLPSGDPFSKS

DNDMFKDGLRRAQSTDSLGTSSSLQSKALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTVSLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLLSSV

TQGMESAYVSPSGYRLVSETEWNLLQKE VHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQ VKKLQLMLRQANDQLEKTMKEKQELEDFLKQSAED

SSHQ ISALVLRAQASEVLLEELQQSFSQAKRDVQEQM - UNI4291 - AVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQLAEDFILPDTVE -

 UNI7603 - VLRELVLKYRENIVHVRTAADHMEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIA - UNI7369 - ASISSLKAELER

IKVEKGQ - UNI7369 - LESTLREKSQQLESLQEMKVNLEEQLKKETAAK ATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQ VQLERI

RQADSLERIRAILNDTKLTDINQLPET
Transcript ENSMUST00000108533
Sequence
ATTTCCCGCTGTCAGGATGAGGAGGCGGAGGTCGGCGCTCCGGTCCGTCTCTGCCCGAGGCTGTGGCGGCGCCGGCGGCTCCAGCCTTAGCGGTTCCTCC

CTGGGCGGCGGTGGCCGCGGCTCGGTCGACGCCTCCTCCGCCAGCTGAGCCCGCGGCATCCCGGGACGCCGCTTCCCCGCCCATCCCCGTTCTCCGAGGC

CGCCCACTGGCCATGGCGCAGCCGGGCCCGGCTCCCCAGCCTGACG - UNI5651 - TTTCTCTTCAGCAACGGGTAGCAGAATTGGAAAAAATTAAT

GCAGAATTTTTACGTGCACAGCAGCAGCTTGAGCAAGAATTTAATCAAAAGAGAGCAAAATTTAAGGAGCTCTATTTGGCTAAAGAGG AGGATCTGAAG

AGGCAAAATGCAGTATTGCAAGCTGCACAGGACGATTTGGGTCACCTTCGGACACAGCTGTGGGAGGCTCAGGCAGAGATGGAGAACATTAAGGCAATTG

CCACAGTCTCTGAGAATACTAAGCAAGAAGCTATAGATGAAGTTAAAAGGCAATGGAGAGAAGAAGTTGCTTCACTTCAGGCTATAATGAAAG AGACAG

TCCGTGACTATGAGCATCAGTTTCACCTGAGGCTGGAGCAGGAGCGAGCACAGTGGGCACAGTATCGAGAATCTGCAGAGCGGGAAATAGCTGACTTAAG

AAGAAGGTTGTCTGAAGGTCAAGAGGAAGAAAATTTAGAAAATGAAATGAAAAAG - UNI4121 - GCCCAAGAGGATGCTGAAAAGCTTCGTTCTGT

CGTGATGCCCATGGAGAAGGAAATTGCAGCTCTGAAAGATAAACTGACAGAAGCTGAAGACAAGATTAAAGAGCTGGAGGCCTCAAAGGTT - UNI741

8 - GTTAAGGAGCTGAATCATTATCTGGAGGCCGAGAAGTCTTGCAGGACTGACCTGGAGATGTACGTAGCTGTTTTGAACACTCAGAAATCTGTGCTA

CAGGAAGATGCTGAGAAATTGAGGAAAGAACTGCATGAAG TTTGCCATCTCTTGGAACAAGAACGACAACAACACAACCAGTTAAAGCATACATGGCAG

AAGGCCAACGACCAGTTTCTGGAATCTCAGCGTTTGCTGATGAGAGACATGCAGAGAATGGAGATTGTGTTAACTTCGGAACAGCTCCGACAAGTTGAAG

AACTAAAGAAGAAAGACCAG GAGGAGGATGAACAACAAAGGGTCAATAAGAGAAAAGATAACAAGAAAACAGATACCGAAGAAGAAGTAAAAATACCAG

TAGTGTGTGCTTTAACTCAAGAAGAATCTTCAACCCCATTATCAAATGAAGAG GAGCATTTAGACAGCACCCATGGGTCAGTCCATTCCTTGGATGCAG

ACTTGATGTTACCATCTGGAGATCCATTTAGTAAATCGGACAATGACATGTTTAAAGATGGACTCAGGAGAGCTCAGTCTACAGACAGCTTGGGAACCTC

AAGCTCATTGCAATCCAAAGCTTTAGGCTATAACTACAAAGCGAAATCTGCTGGAAATTTGGATGAGTCGGATTTTGGACCACTGGTTGGAGCAGATTCT

GTGTCTGAGAACTTTGATACTGTGTCCCTTGGGTCACTGCAGATGCCAAGTGGATTTATGTTAACCAAAGATCAAGAAAGAGCAATTAAGGCAATGACAC

CTGAGCAGGAGGAGACAGCATCCCTCCTCTCCAGTGTCACCCAGGGTATGGAGAGTGCATATGTATCTCCCAGTGGTTACCGCTTAGTGAGTGAGACGGA

ATGGAATCTCCTGCAGAAAGAG GTGAAAAAACTGCAGTTAATGCTCAGGCAAGCTAATGACCAGCTTGAGAAGACGATGAAAGAGAAGCAGGAGCTGGA

GGACTTCCTCAAGCAGAGTGCGGAGGACTCAAGCCACCAG ATATCTGCACTTGTTTTAAGAGCCCAAGCCTCTGAGGTCTTACTTGAAGAGTTACAACA

GAGCTTTTCCCAAGCAAAGAGGGACGTTCAGGAGCAGATG - UNI4291 - GCGGTGCTGATGCAGTCACGTGAACAGGTTTCAGAAGAGTTGGTGAG

GTTACAGAAAGACAACGACAGCCTCCAGGGGAAGCACAGCTTGCATGTGTCATTACAGCTAGCAGAAGACTTCATTCTTCCAGACACTGTGGAG - UNI

7603 - GTGCTCCGGGAACTGGTTTTAAAATATCGTGAGAACATTGTTCATGTGCGCACAGCAGCAGACCACATGGAAGAGAAGCTGAAGGCGGAAATA

CTTTTCCTAAAAGAGCAAATTCAAGCGGAACAGTGTTTAAAAGAAAACCTGGAAGAGACACTACAGCTGGAAATAGAAAACTGCAAGGAGGAAATAG - 

UNI7369 - CTTCCATTTCTAGTCTAAAAGCTGAATTAGAAAGAATAAAGGTTGAAAAGGGACAG - UNI7369 - TTGGAATCTACATTAAGAGAG

AAGTCGCAACAACTTGAGAGTCTCCAAGAAATGAAAGTTAATTTAGAGGAACAGTTAAAGAAAGAAACTGCTGCTAAG GCTACTGTTGAACAGCTCATG

TTTGAAGAGAAGAACAAAGCTCAGAGGTTGCAGACAGAATTAGATGTCAGTGAACAAGTACAGAGAGATTTTGTAAAACTTTCTCAGACTCTTCAGGTGA

GGTGTTTGGGGAACCACCATGGCCCTTCTGTGGGAGGGGGCACCAATGTAGCTGGAGGACTTGGATCGCCTCTATCTCTACCTCAGATCTTTGCATGA
Translation
MAQPGPAPQPDV - UNI5651 - VSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEE EDLKRQNAVLQAAQDDLGHLRTQLWEAQAE

MENIKAIATVSENTKQEAIDEVKRQWREEVASLQAIMKE ETVRDYEHQFHLRLEQERAQWAQYRESAEREIADLRRRLSEGQEEENLENEMKK - UNI

4121 - AQEDAEKLRSVVMPMEKEIAALKDKLTEAEDKIKELEASKV - UNI7418 - VKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKL

RKELHEV VCHLLEQERQQHNQLKHTWQKANDQFLESQRLLMRDMQRMEIVLTSEQLRQVEELKKKDQ EEDEQQRVNKRKDNKKTDTEEEVKIPVVCAL

TQEESSTPLSNEE EHLDSTHGSVHSLDADLMLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSSSLQSKALGYNYKAKSAGNLDESDFGPLVGADSVSEN

FDTVSLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKE VKKLQLMLRQANDQLEKTMKEKQELEDFL

KQSAEDSSHQ ISALVLRAQASEVLLEELQQSFSQAKRDVQEQM - UNI4291 - AVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQLAEDFILP

DTVE - UNI7603 - VLRELVLKYRENIVHVRTAADHMEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIA - UNI7369 - ASISSL

KAELERIKVEKGQ - UNI7369 - LESTLREKSQQLESLQEMKVNLEEQLKKETAAK ATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQV

RCLGNHHGPSVGGGTNVAGGLGSPLSLPQIFA

For any suggestions or comments, please send an email to unitrap@crg.es