Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020823 (Sec14l1)
Chromosomal location
Chr 11: 116976552 - 117020582 (+)
Description
SEC14-like 1 (S. cerevisiae) Gene [Source:MGI (curated);Acc:Sec14l1-007]
RefSeq_dna
NM_028777 
RefSeq_peptide
NP_083053.1 
UniGene
Mm.272312 Mm.474931 
MGI
MGI:1921386 
Uniprot/SPTREMBL
A2A9B9 A8Y5H7 Q6A071 Q8BXE6 Q9DBQ0 Q99J07 
Human Ortholog
ENSG00000129657 (SEC14L1)
Omim not available
UniTrap UNI18104
Vector Insertion
Chr 11: 116978473 - 116978567
Public Clones not available
Private Clones OST430170 (lexicon) OST391009 (lexicon) OST323853 (lexicon) OST283451 (lexicon)
OST258052 (lexicon) OST198626 (lexicon) OST194128 (lexicon) OST170534 (lexicon)
OST143638 (lexicon) OST134153 (lexicon) OST121434 (lexicon) OST121411 (lexicon)
OST121397 (lexicon) OST121363 (lexicon) OST112854 (lexicon) OST112846 (lexicon)
OST107048 (lexicon) OST49942 (lexicon) OST39030 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18413
Vector Insertion
Chr 11: 116978567 - 117002731
Public Clones D068B04 (ggtc) CMHD-GT_452F8-3 (cmhd) IST12509B11 (tigm)
Private Clones OST423889 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26391
Vector Insertion
Chr 11: 117002882 - 117002975
Public Clones not available
Private Clones OST121430 (lexicon) OST42574 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38624
Vector Insertion
Chr 11: 117006273 - 117008421
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24617
Vector Insertion
Chr 11: 117018114 - 117020084
Public Clones not available
Private Clones OST212734 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021177
Sequence
GGCGGTCGAGCGGCGGCAGCCGAGCCTGTGGCACGGCTCTCTCTTCGGGGAGCCGCCGGCATGAACGCATCCCGCCACCGCGCCGCGTCCCCGACCCGGT

CCTTCTGACAAGAG - UNI18104 - GAGTAAGAAGACTGCTATTGAATTACAACCATGGTGCAAAAATACCAGTCCCCAGTGCGGGTGTATAAACAT

CCCTTTGAGTTAATTATGGCT - UNI18104 - - UNI18413 - GCCTATGAGAGGAGGTTTCCTACATGTCCTCTGATTCCAATGTTCGTGGACA

GTGACACTGTGAGCGAGTTCAAGAGTGAGGATGGGGCTCTTCATGTCATCGAGAGGCGCTGCAAGCTGGATATAGATGCGCCCAGGCTGTTGAAGAAG -

 UNI26391 - ATCGCAGGAGTCGATTACGTTTATTTTGTCCAGAAAAACTCCCTGAATTCTCGAGATCGCACTTTGCACATCGAGGCCCACAATGAGA

CATTTTCTAACCGGGTCATCATCCACGAACACTGCTGTTACACG GTTCACCCTGAGAATGAAGACTGGACCTGTTTCGAACAGTCTGCAAGTTTAGATA

TCAAATCCTTCTTTGGTTTTGAAAGTACAGTGGAAAAAATTGCCATGAAACATTATACAAGCAACATTAAAAAA GGGAAGGAGATCATTGAATACTACC

TACGGCAGCTGGAGGAGGAAGGCATCACCTTCGTGCCCCGCTGGACCCCACCCCCCGTGGGACCCTCAGAAACATGTTCATCAAGCAAGAATCAAGTCAC

ATCTGCAGCTGTCCTTGTCCCAGATGCTGCTGCCGTCATGGAGGGGCTGAGTGGGGAAAACCTCAGTAGCCCAGGAACAGCGTCTGAGCCCGTGGTGGGA

ACCCCTGACG ATAAATTAGATGCCGACTACATCAAGAGATACTTGGGTGACCTGACTCCCCTCCAAGAGAGCTGCCTCATTCGACTGCGCCAGTGGCTC

CAGGAGACACACAAGGGCAAG ATCCCAAAGGACGAGCATATCCTTCGGTTCCTGCGTGCCCGGGATTTTAATATTGACAAGGCCAGAGAGATCATGTGC

CAGTCTCTAACCTGGCGGAAGCAGCACCAGGTGGATTACATCCTGGACACTTGGACTCCGCCCCAGGTCCTTCTGGACTACTACGCTGGGGGCTGGCATC

ACCATGACAAAG ATGGACGGCCGCTGTATGTGCTTAGGCTGGGCCAGATGGACACCAAAGGCTTGGTGCGAGCTCTCGGAGAGGAGGCCCTACTGCGAT

AC GTTCTTTCCATAAACGAAGAAGGCCTGAGACGATGCGAGGAAAACACCAAGGTCTTCGGCCGGCCAATCAG CTCGTGGACCTGCTTGGTGGACCTT

GAAGGACTGAACATGCGCCATCTGTGGAGACCAGGGGTCAAAGCCTTGCTGCGCATCATCGAGGTGGTGGAGGCCAACTACCCGGAGACGCTGGGCCGCC

TCCTCATCCTCCGAGCCCCCAGGGTCTTCCCTGTCCTCTGGACGCTG GTTAGTCCATTTATTGATGACAACACCAGAAGGAAGTTCCTCATTTATGCAG

GAAATGACTACCAGGGCCCAGGAGGCCTGCTGGATTACATCGATAAAGAGATTATTCCCGATTTCCTGAGTGGGGAGTGCATG TGTGACGTGCCAGAGG

GTGGATTGGTCCCCAAATCCTTGTACAGGACTGCAGAGGAGCTGGAAAATGAAGACCTGAAGCTCTGGACGGAGACCATCTACCAGTCTGCCAGCGTGTT

CAAAGGAGCTCCACATGAG ATTCTCATTCAGATTGTGGACGCCTCCTCAGTGATCACCTGGGATTTTGATGTGTGCAAAGGGGACATCGTCTTTAACAT

TTATCACTCCAAGAGGTCTCCCCAGCCACCCAAGAAGGACTCGCTAGGGGCTCACAGCATCACTTCCCCAGGAGGCAACAACGTGCAGCTGATAGACAAA

GTCTGGCAGCTGGGCCGGGACTATAGCATGGTGGAGTCTCCTCTAATCTGCAAAGAAGGAGAGAGCGTGCAG GGGTCCCATGTGACCAGGTGGCCAGGC

TTCTACATCCTACAGTGGAAATTCCACACCATGCCAGCATGTGCTGCCACCAACCTACCCCGAGTGGACGACGTGCTGGCCTCCCTGCAGGTCTCCTCCC

ACAAGTGCAAAGTCATGTACTACACAGAAGTGATCGGCTCTGAAGATTTCAG - UNI24617 - AGGCTCCATGACCAGCCTGGAATCTAGCCACAGC

GGGTTCTCACAGCTCAGTGCCGCCACCACCTCCTCCAGCCAGTCGCAATCCAGCTCCATGATTTCCAG - UNI24617 - ATGGCGATTTTGCTGA
Translation
 - UNI18104 - MVQKYQSPVRVYKHPFELIMA - UNI18104 - - UNI18413 - AYERRFPTCPLIPMFVDSDTVSEFKSEDGALHVIERRC

KLDIDAPRLLKK - UNI26391 - IAGVDYVYFVQKNSLNSRDRTLHIEAHNETFSNRVIIHEHCCYT VHPENEDWTCFEQSASLDIKSFFGFESTV

EKIAMKHYTSNIKK GKEIIEYYLRQLEEEGITFVPRWTPPPVGPSETCSSSKNQVTSAAVLVPDAAAVMEGLSGENLSSPGTASEPVVGTPDD DKLDA

DYIKRYLGDLTPLQESCLIRLRQWLQETHKGK IPKDEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLLDYYAGGWHHHDKD DG

RPLYVLRLGQMDTKGLVRALGEEALLRY VLSINEEGLRRCEENTKVFGRPIS SSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLIL

RAPRVFPVLWTL VSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGECM CDVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKG

APHE ILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQ GSHVTRWPGF

YILQWKFHTMPACAATNLPRVDDVLASLQVSSHKCKVMYYTEVIGSEDFR - UNI24617 - RGSMTSLESSHSGFSQLSAATTSSSQSQSSSMISR 

- UNI24617 - RWRFC
Transcript ENSMUST00000103026
Sequence
GGCGGTCGAGCGGCGGCAGCCGAGCCTGTGGCACGGCTCTCTCTTCGGGGAGCCGCCGGCATGAACGCATCCCGCCACCGCGCCGCGTCCCCGACCCGGT

CCTTCTGACAAGAG - UNI18104 - GAGTAAGAAGACTGCTATTGAATTACAACCATGGTGCAAAAATACCAGTCCCCAGTGCGGGTGTATAAACAT

CCCTTTGAGTTAATTATGGCT - UNI18104 - - UNI18413 - GCCTATGAGAGGAGGTTTCCTACATGTCCTCTGATTCCAATGTTCGTGGACA

GTGACACTGTGAGCGAGTTCAAGAGTGAGGATGGGGCTCTTCATGTCATCGAGAGGCGCTGCAAGCTGGATATAGATGCGCCCAGGCTGTTGAAGAAG -

 UNI26391 - ATCGCAGGAGTCGATTACGTTTATTTTGTCCAGAAAAACTCCCTGAATTCTCGAGATCGCACTTTGCACATCGAGGCCCACAATGAGA

CATTTTCTAACCGGGTCATCATCCACGAACACTGCTGTTACACG GTTCACCCTGAGAATGAAGACTGGACCTGTTTCGAACAGTCTGCAAGTTTAGATA

TCAAATCCTTCTTTGGTTTTGAAAGTACAGTGGAAAAAATTGCCATGAAACATTATACAAGCAACATTAAAAAA GGGAAGGAGATCATTGAATACTACC

TACGGCAGCTGGAGGAGGAAGGCATCACCTTCGTGCCCCGCTGGACCCCACCCCCCGTGGGACCCTCAGAAACATGTTCATCAAGCAAGAATCAAGTCAC

ATCTGCAGCTGTCCTTGTCCCAGATGCTGCTGCCGTCATGGAGGGGCTGAGTGGGGAAAACCTCAGTAGCCCAGGAACAGCGTCTGAGCCCGTGGTGGGA

ACCCCTGACG ATAAATTAGATGCCGACTACATCAAGAGATACTTGGGTGACCTGACTCCCCTCCAAGAGAGCTGCCTCATTCGACTGCGCCAGTGGCTC

CAGGAGACACACAAGGGCAAG ATCCCAAAGGACGAGCATATCCTTCGGTTCCTGCGTGCCCGGGATTTTAATATTGACAAGGCCAGAGAGATCATGTGC

CAGTCTCTAACCTGGCGGAAGCAGCACCAGGTGGATTACATCCTGGACACTTGGACTCCGCCCCAGGTCCTTCTGGACTACTACGCTGGGGGCTGGCATC

ACCATGACAAAG ATGGACGGCCGCTGTATGTGCTTAGGCTGGGCCAGATGGACACCAAAGGCTTGGTGCGAGCTCTCGGAGAGGAGGCCCTACTGCGAT

AC GTTCTTTCCATAAACGAAGAAGGCCTGAGACGATGCGAGGAAAACACCAAGGTCTTCGGCCGGCCAATCAG CTCGTGGACCTGCTTGGTGGACCTT

GAAGGACTGAACATGCGCCATCTGTGGAGACCAGGGGTCAAAGCCTTGCTGCGCATCATCGAGGTGGTGGAGGCCAACTACCCGGAGACGCTGGGCCGCC

TCCTCATCCTCCGAGCCCCCAGGGTCTTCCCTGTCCTCTGGACGCTG GTTAGTCCATTTATTGATGACAACACCAGAAGGAAGTTCCTCATTTATGCAG

GAAATGACTACCAGGGCCCAGGAGGCCTGCTGGATTACATCGATAAAGAGATTATTCCCGATTTCCTGAGTGGGGAGTGCATG TGTGACGTGCCAGAGG

GTGGATTGGTCCCCAAATCCTTGTACAGGACTGCAGAGGAGCTGGAAAATGAAGACCTGAAGCTCTGGACGGAGACCATCTACCAGTCTGCCAGCGTGTT

CAAAGGAGCTCCACATGAG ATTCTCATTCAGATTGTGGACGCCTCCTCAGTGATCACCTGGGATTTTGATGTGTGCAAAGGGGACATCGTCTTTAACAT

TTATCACTCCAAGAGGTCTCCCCAGCCACCCAAGAAGGACTCGCTAGGGGCTCACAGCATCACTTCCCCAGGAGGCAACAACGTGCAGCTGATAGACAAA

GTCTGGCAGCTGGGCCGGGACTATAGCATGGTGGAGTCTCCTCTAATCTGCAAAGAAGGAGAGAGCGTGCAG GGGTCCCATGTGACCAGGTGGCCAGGC

TTCTACATCCTACAGTGGAAATTCCACACCATGCCAGCATGTGCTGCCACCAACCTACCCCGAGTGGACGACGTGCTGGCCTCCCTGCAGGTCTCCTCCC

ACAAGTGCAAAGTCATGTACTACACAGAAGTGATCGGCTCTGAAGATTTCAG - UNI24617 - AGGCTCCATGACCAGCCTGGAATCTAGCCACAGC

GGGTTCTCACAGCTCAGTGCCGCCACCACCTCCTCCAGCCAGTCGCAATCCAGCTCCATGATTTCCAG - UNI24617 - TGAATGACTTGTGTGACA

CCCTGCAGAGACTCGCCACCTCCTCCTCCACGGAACCGAAGCTGCAGCAGGCAGCCCTTAAGCTGCAGCGGAGTCCTCTCGGCTCCCTGTTAGTGGAGGT

GGCCTGTGGATCCAGAACAGCTCTTGAGGTCCCTTTCCGCTAAGGACTTGGCAGCCTGAGGAGCACCCAGTGCTGGGTCAGAGCCAGCCTGATCCCGAGC

AGACACTGCAGCCCAGGAGGGGCTGCCAGGGCTCCTCGTGAATCCTGACAACACCGCCATCATTAAACATTGCTTTCTCTTTC
Translation
 - UNI18104 - MVQKYQSPVRVYKHPFELIMA - UNI18104 - - UNI18413 - AYERRFPTCPLIPMFVDSDTVSEFKSEDGALHVIERRC

KLDIDAPRLLKK - UNI26391 - IAGVDYVYFVQKNSLNSRDRTLHIEAHNETFSNRVIIHEHCCYT VHPENEDWTCFEQSASLDIKSFFGFESTV

EKIAMKHYTSNIKK GKEIIEYYLRQLEEEGITFVPRWTPPPVGPSETCSSSKNQVTSAAVLVPDAAAVMEGLSGENLSSPGTASEPVVGTPDD DKLDA

DYIKRYLGDLTPLQESCLIRLRQWLQETHKGK IPKDEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLLDYYAGGWHHHDKD DG

RPLYVLRLGQMDTKGLVRALGEEALLRY VLSINEEGLRRCEENTKVFGRPIS SSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLIL

RAPRVFPVLWTL VSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGECM CDVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKG

APHE ILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQ GSHVTRWPGF

YILQWKFHTMPACAATNLPRVDDVLASLQVSSHKCKVMYYTEVIGSEDFR - UNI24617 - RGSMTSLESSHSGFSQLSAATTSSSQSQSSSMISS 

- UNI24617 - SE
Transcript ENSMUST00000090433
Sequence
GGCGGTCGAGCGGCGGCAGCCGAGCCTGTGGCACGGCTCTCTCTTCGGGGAGCCGCCGGCATGAACGCATCCCGCCACCGCGCCGCGTCCCCGACCCGGT

CCTTCTGACAAGAG - UNI18104 - GAGTAAGAAGACTGCTATTGAATTACAACCATGGTGCAAAAATACCAGTCCCCAGTGCGGGTGTATAAACAT

CCCTTTGAGTTAATTATGGCT - UNI18104 - - UNI18413 - GCCTATGAGAGGAGGTTTCCTACATGTCCTCTGATTCCAATGTTCGTGGACA

GTGACACTGTGAGCGAGTTCAAGAGTGAGGATGGGGCTCTTCATGTCATCGAGAGGCGCTGCAAGCTGGATATAGATGCGCCCAGGCTGTTGAAGAAG -

 UNI26391 - ATCGCAGGAGTCGATTACGTTTATTTTGTCCAGAAAAACTCCCTGAATTCTCGAGATCGCACTTTGCACATCGAGGCCCACAATGAGA

CATTTTCTAACCGGGTCATCATCCACGAACACTGCTGTTACACG GTTCACCCTGAGAATGAAGACTGGACCTGTTTCGAACAGTCTGCAAGTTTAGATA

TCAAATCCTTCTTTGGTTTTGAAAGTACAGTGGAAAAAATTGCCATGAAACATTATACAAGCAACATTAAAAAA GGGAAGGAGATCATTGAATACTACC

TACGGCAGCTGGAGGAGGAAGGCATCACCTTCGTGCCCCGCTGGACCCCACCCCCCGTGGGACCCTCAGAAACATGTTCATCAAGCAAGAATCAAGTCAC

ATCTGCAGCTGTCCTTGTCCCAGATGCTGCTGCCGTCATGGAGGGGCTGAGTGGGGAAAACCTCAGTAGCCCAGGAACAGCGTCTGAGCCCGTGGTGGGA

ACCCCTGACG ATAAATTAGATGCCGACTACATCAAGAGATACTTGGGTGACCTGACTCCCCTCCAAGAGAGCTGCCTCATTCGACTGCGCCAGTGGCTC

CAGGAGACACACAAGGGCAAG ATCCCAAAGGACGAGCATATCCTTCGGTTCCTGCGTGCCCGGGATTTTAATATTGACAAGGCCAGAGAGATCATGTGC

CAGTCTCTAACCTGGCGGAAGCAGCACCAGGTGGATTACATCCTGGACACTTGGACTCCGCCCCAGGTCCTTCTGGACTACTACGCTGGGGGCTGGCATC

ACCATGACAAAG ATGGACGGCCGCTGTATGTGCTTAGGCTGGGCCAGATGGACACCAAAGGCTTGGTGCGAGCTCTCGGAGAGGAGGCCCTACTGCGAT

AC GTTCTTTCCATAAACGAAGAAGGCCTGAGACGATGCGAGGAAAACACCAAGGTCTTCGGCCGGCCAATCAG CTCGTGGACCTGCTTGGTGGACCTT

GAAGGACTGAACATGCGCCATCTGTGGAGACCAGGGGTCAAAGCCTTGCTGCGCATCATCGAGGTGGTGGAGGCCAACTACCCGGAGACGCTGGGCCGCC

TCCTCATCCTCCGAGCCCCCAGGGTCTTCCCTGTCCTCTGGACGCTG GTTAGTCCATTTATTGATGACAACACCAGAAGGAAGTTCCTCATTTATGCAG

GAAATGACTACCAGGGCCCAGGAGGCCTGCTGGATTACATCGATAAAGAGATTATTCCCGATTTCCTGAGTGGGGAGTGCATG TGTGACGTGCCAGAGG

GTGGATTGGTCCCCAAATCCTTGTACAGGACTGCAGAGGAGCTGGAAAATGAAGACCTGAAGCTCTGGACGGAGACCATCTACCAGTCTGCCAGCGTGTT

CAAAGGAGCTCCACATGAG ATTCTCATTCAGATTGTGGACGCCTCCTCAGTGATCACCTGGGATTTTGATGTGTGCAAAGGGGACATCGTCTTTAACAT

TTATCACTCCAAGAGGTCTCCCCAGCCACCCAAGAAGGACTCGCTAGGGGCTCACAGCATCACTTCCCCAGGAGGCAACAACGTGCAGCTGATAGACAAA

GTCTGGCAGCTGGGCCGGGACTATAGCATGGTGGAGTCTCCTCTAATCTGCAAAGAAGGAGAGAGCGTGCAG GGGTCCCATGTGACCAGGTGGCCAGGC

TTCTACATCCTACAGTGGAAATTCCACACCATGCCAGCATGTGCTGCCACCAACCTACCCCGAGTGGACGACGTGCTGGCCTCCCTGCAGGTCTCCTCCC

ACAAGTGCAAAGTCATGTACTACACAGAAGTGATCGGCTCTGAAGATTTCAG - UNI24617 - AGGCTCCATGACCAGCCTGGAATCTAGCCACAGC

GGGTTCTCACAGCTCAGTGCCGCCACCACCTCCTCCAGCCAGTCGCAATCCAGCTCCATGATTTCCAGGTAGTGCCGCGAAGCCTGCGCCTGCGCGGAGG

GCGGGCGCCCCGGCTGCTGTGCTCCGCCCACCCCAGGATGTGCAGACTCCGCCCACCCCTGGATGTGCAGACTCCTCCCTCTAGATAGCAGCTAGATCTG

CAGATGGTCACTAGTCACCTGGTCCCCAGACCATCCTGAGAGGTAGTTTTAACTCTACCCCTAACTTTAACTCAATAGCCATAGATTTTGTATACAGCGT

GCACAAAATCAAACCAGAGCACAAGGGCTCTCGAAAGAAAAGTAGTTTATCTACAGTAAGAGACTGACTGGTCTCAGTTGTCGATGCAAAAAATGTTACC

AACAAACTCCACCTTGTCCACTAGTGAATGACTTGTGTGACACCCTGCAGAGACTCGCCACCTCCTCCTCCACGGAACCGAAGCTGCAGCAGGCAGCCCT

TAAGCTGCAGCGGAGTCCTCTCGGCTCCCTGTTAGTGGAGGTGGCCTGTGGATCCAGAACAGCTCTTGAGGTCCCTTTCCGCTAAGGACTTGGCAGCCTG

AGGAGCACCCAGTGCTGGGTCAGAGCCAGCCTGATCCCGAGCAGACACTGCAGCCCAGGAGGGGCTGCCAGGGCTCCTCGTGAATCCTGACAACACCGCC

ATCATTAAACATTGCTTTCTCTTTCCTCCTCTTCAAATCTTTTGATATTTTTCAGAGCAAAATTTTTCTGTCCGTGAACTTGGTGGAGGGGATGGGGAGG

ATTCTTTCCCTCTGCTGAGTGCTGCCTTTCCTTCTGCAGGAGGCGGCTCTGTGCCCGTAGCACCCAGGGTCCTCAGTCCTCTCAGAACCCAGGGTCCTCA

GTCCTCCCAAAACCCAGGGTTCTCAGCCCTTAGCACCCAGGGTACTCAGTCCTCCCAAAACCCAGGGTTCTCAGCCCTTAGCACCCAGGGTACTCAGTCC

TCCCAGCAGCACCCAGAGTCCTCAGTCTTCCTAGCACCCAGGATCCTCAGTCCTAGCACCCAGGGTCCTCAGCTCTCAGCAGGGTGTTTGGAAGCAGTAG

GTCACACTTGCCTTTAGAAGTGTGGCAGTGCAAACTCTAGCAATGCTCTCCAGGGGGGTGCATGGCTTGCAGTGGCCTTCGGCATGTGGGTGGATGCTGG

GTATGTGTGTAGGTGTTGTGTGTGTGCATGAGGGAGTGGGGTGTAGCTGGGGAGGGGCTGCAGATCTGCACTTGTTCTTCTGCGTTTCATAGAAGCAGGT

CAGAGGCTGGGGCTAGTTTGCCTTTTTTCTTCTTTCTTTTTTTTCCCCTGATCTTGACTCCCCAGAGCCTGCTGTTGGAGCAGATCCTTGCTTTACGGCT

TTTATGGGGAAAGCATGCTTCTTAGCGAACTGTCTAGAAGTTGCAGGTGGCTGATCTCCAGAGGAGGGGGGCCCAGGATCTACTTGTGTGTGTGTGGTAA

CAGTGTCTAAAGATGTGTGCCAAATCCGAGTGGCCATGAGAGTGTATGGCGGGAGTGGATGCCTGTGTAGACGCTGCTCTGAGGCTCTGGGTGGCTGGCT

GTGCGGTGAGAGCTATGGAGAGGCTGTGGCATGTCAGCAAGCATGAGGAGAGCCGACACAGCAGCCTGGCTTGGCCGATGAGCCCCCTGGCTCCTGGCAC

CCTGAGCCGTGCTTGAGCCTCTGTTTGGTGGCCTTTCTGGCCCACTGCCATGCCTTTCCTGTCTGTGGGAGCGCTTGTACACAGCACAGCAGGGCTGTAG

CTACCGCGTCCATGCTGCTTCCAGTCAGGGCTTCCCAGCTCCGAGTGAAAGGACCTGAAGATGCCCCTGCTCTTTCTCTCTTCTCTCTCCCTTCCCCTCT

CCCTTTCTCCATGTCCCAGATGGCGATTTTGCTGACATCCTCCAAGAAAGCGCTTCACTCGACAGCCCACATGTGCCCAGAGATGTTTGTAGACCTATCT

GAGTCGCAGCCATGTCCCAGGCTGAAGAGCTGTTCCCCTTAAGTCCATGCCGAAGAGGCACTGTTGAACCCCCCAGAGCTGAGAGCATCTTTAAGAGCTC

AAAGCACACAACTGCACACTCACAGGCCCTCAGCTTCCCCGAGCCACAGGGCACTGGCTGCCCTGTAAGGGGAGGCTGGCTACGAGGTGACCGTGTGGCT

CGCACACGGGGCTGCTCCTCCCAGTGCCCAGCACCTCCTAAAATGCTGCTCCCTCCACTCTGGGCTCTCCCTGTTTCTAGTGTCTTAACCCATTCTCCTT

CCTGAATCCATTCTTTGCATATCAGATTCTGTAAATGTTTTGTAAACATATTACCTCACTCTTGGTAATACAATACTGATAGTCTTTAAAAGATTTTTTT

ATTGTTACAATAATAAATGTGAACTGTTTAAGAA
Translation
 - UNI18104 - MVQKYQSPVRVYKHPFELIMA - UNI18104 - - UNI18413 - AYERRFPTCPLIPMFVDSDTVSEFKSEDGALHVIERRC

KLDIDAPRLLKK - UNI26391 - IAGVDYVYFVQKNSLNSRDRTLHIEAHNETFSNRVIIHEHCCYT VHPENEDWTCFEQSASLDIKSFFGFESTV

EKIAMKHYTSNIKK GKEIIEYYLRQLEEEGITFVPRWTPPPVGPSETCSSSKNQVTSAAVLVPDAAAVMEGLSGENLSSPGTASEPVVGTPDD DKLDA

DYIKRYLGDLTPLQESCLIRLRQWLQETHKGK IPKDEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLLDYYAGGWHHHDKD DG

RPLYVLRLGQMDTKGLVRALGEEALLRY VLSINEEGLRRCEENTKVFGRPIS SSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLIL

RAPRVFPVLWTL VSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGECM CDVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKG

APHE ILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQ GSHVTRWPGF

YILQWKFHTMPACAATNLPRVDDVLASLQVSSHKCKVMYYTEVIGSEDFR - UNI24617 - RGSMTSLESSHSGFSQLSAATTSSSQSQSSSMISR

For any suggestions or comments, please send an email to unitrap@crg.es