Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020826 (Nos2)
Chromosomal location
Chr 11: 78734353 - 78773727 (+)
Description
nitric oxide synthase 2, inducible Gene [Source:MGI (curated);Acc:Nos2-001]
RefSeq_dna
NM_010927 
RefSeq_peptide
NP_035057.1 
UniGene
Mm.2893 
MGI
MGI:97361 
Uniprot/SWISSPROT
P29477 
Human Ortholog
ENSG00000007171 (NOS2A)
Omim not available
UniTrap UNI33207
Vector Insertion
Chr 11: 78745231 - 78748853
Public Clones IST13716B12 (tigm) IST13985H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000018610
Sequence
GAGACTCTGGCCCCACGGGACACAGTGTCACTGGTTTGAAACTTCTCAGCCACCTTGGTGAAGGGACTGAGCTGTTAGAGACACTTCTGAGGCTCCTCAC

GCTTGGGTCTTGTTCACTCCACGGAGTAGCCTAGTCAACTGCAAG AGAACGGAGAACGTTGGATTTGGAGCAGAAGTGCAAAGTCTCAGACATGGCTTG

CCCCTGGAAGTTTCTCTTCAAAGTCAAATCCTACCAAAGTGACCTGAAAGAGGAAAAGGACATTAACAACAACGTGAAGAAAACCCCTTGTGCTGTTCTC

AG CCCAACAATACAAGATGACCCTAAGAGTCACCAAAATGGCTCCCCGCAGCTCCTCACTGGGACAGCACAG AATGTTCCAGAATCCCTGGACAAGCT

GCATGTGACATCGACCCGTCCACAGTATGTGAGGATCAAAAACTGGGGCAGTGGAGAGATTTTGCATGACACTCTTCACCACAAGGCCACATCG GATTT

CACTTGCAAGTCCAAGTCTTGCTTGGGGTCCATCATGAACCCCAAGAGTTTGACCAGAGGACCCAGAGACAAGCCTACCCCTCTGGAGGAGCTCCTGCCT

CATGCCATTGAGTTCATCAACCAGTATTATGGCTCCTTTAAAGA - UNI33207 - GGCAAAAATAGAGGAACATCTGGCCAGGCTGGAAGCTGTAAC

AAAGGAAATAGAAACAACAGGAACCTACCAGCTCACTCTGGATGAGCTCATCTTTGCCACCAAGATGGCCTGGAGGAATGCCCCTCGCTGCATCGGCAGG

ATCCAGTGGTCCAACCTGCAG GTCTTTGACGCTCGGAACTGTAGCACAGCACAGGAAATGTTTCAGCACATCTGCAGACACATACTTTATGCCACCAAC

AATGGCAACATCAG GTCGGCCATCACTGTGTTCCCCCAGCGGAGTGACGGCAAACATGACTTCAGGCTCTGGAATTCACAGCTCATCCGGTACGCTGGC

TACCAGATGCCCGATGGCACCATCAGAGGGGATGCTGCCACCTTGGAGTTCACCCAG TTGTGCATCGACCTAGGCTGGAAGCCCCGCTATGGCCGCTTT

GATGTGCTGCCTCTGGTCTTGCAAGCTGATGGTCAAGATCCAGAGGTCTTTGAAATCCCTCCTGATCTTGTGTTGGAGGTGACCATGGAGCATCCCAA G

TACGAGTGGTTCCAGGAGCTCGGGTTGAAGTGGTATGCACTGCCTGCCGTGGCCAACATGCTACTGGAGGTGGGTGGCCTCGAATTCCCAGCCTGCCCCT

TCAATGGTTGGTACATGGGCACCGAGATTGGAGTTCGAGACTTCTGTGACACACAGCGCTACAACATCCTGGAG GAAGTGGGCCGAAGGATGGGCCTGG

AGACCCACACACTGGCCTCCCTCTGGAAAGACCGGGCTGTCACGGAGATCAATGTGGCTGTGCTCCATAGTTTCCAG AAGCAGAATGTGACCATCATGG

ACCACCACACAGCCTCAGAGTCCTTCATGAAGCACATGCAGAATGAGTACCGGGCCCGTGGAGGCTGCCCGGCAGACTGGATTTGGCTGGTCCCTCCAGT

GTCTGGGAGCATCACCCCTGTGTTCCACCAGGAGATGTTGAACTATGTCCTATCTCCATTCTACTACTACCAG ATCGAGCCCTGGAAGACCCACATCTG

GCAGAATGAGAAGCTGAGGCCCAGGAGGAGAGAGATCCGATTTAGAGTCTTGGTGAA AGTGGTGTTCTTTGCTTCCATGCTAATGCGAAAGGTCATGGC

TTCACGGGTCAGAGCCACAGTCCTCTTTGCTACTGAGACAGGGAAGTCTGAAGCACTAGCCAGGGACCTGGCCACCTTGTTCAGCTACGCCTTCAACACC

AAG GTTGTCTGCATGGACCAGTATAAGGCAAGCACCTTGGAAGAGGAGCAACTACTGCTGGTGGTGACAAGCACATTTGGGAATGGAGACTGTCCCAGC

AATGGGCAG ACTCTGAAGAAATCTCTGTTCATGCTTAGAGAACTCAACCACACCTTCAG GTATGCTGTGTTTGGCCTTGGCTCCAGCATGTACCCTCA

GTTCTGCGCCTTTGCTCATGACATCGACCAGAAGCTGTCCCACCTGGGAGCCTCTCAGCTTGCCCCAACAGGAGAAGGGGACGAACTCAGTGGGCAGGAG

GATGCCTTCCGCAGCTGGGCTGTACAAACCTTCCGG GCAGCCTGTGAGACCTTTGATGTCCGAAGCAAACATCACATTCAGATCCCGAAACGCTTCACT

TCCAATGCAACATGGGAGCCACAGCAATATAGGCTCATCCAGAGCCCGGAGCCTTTAGACCTCAACAGAG CCCTCAGCAGCATCCATGCAAAGAACGTG

TTTACCATGAGGCTGAAATCCCAGCAGAATCTGCAGAGTGAAAAGTCCAG CCGCACCACCCTCCTCGTTCAGCTCACCTTCGAGGGCAGCCGAGGGCCC

AGCTACCTGCCTGGGGAACACCTGGGGATCTTCCCAGGCAACCAGACCGCCCTGGTGCAGGGAATCTTGGAGCGAGTTGTGGATTGTCCTACACCACACC

AAACTGTGTGCCTGGAGGTTCTGGATGAGAGCG GCAGCTACTGGGTCAAAGACAAGAGGCTGCCCCCCTGCTCACTCAGCCAAGCCCTCACCTACTTCC

TGGACATTACGACCCCTCCCACCCAGCTGCAGCTCCACAAGCTGGCTCGCTTTGCCACGGACGAGACGGATAGGCAGAGATTGGAGGCCTTGTGTCAG C

CCTCAGAGTACAATGACTGGAAGTTCAGCAACAACCCCACGTTCCTGGAGGTGCTTGAAGAGTTCCCTTCCTTGCATGTGCCCGCTGCCTTCCTGCTGTC

GCAGCTCCCTATCTTGAAGCCCCGCTACTACTCCATCAGCTCCTCCCAGGACCACACCCCCTCGGAGGTTCACCTCACTGTGGCCGTGGTCACCTACCGC

ACCCGAG ATGGTCAGGGTCCCCTGCACCATGGTGTCTGCAGCACTTGGATCAGGAACCTGAAGCCCCAGGACCCAGTGCCCTGCTTTGTGCGAAG TGT

CAGTGGCTTCCAGCTCCCTGAGGACCCCTCCCAGCCTTGCATCCTCATTGGGCCTGGTACGGGCATTGCTCCCTTCCGAAGTTTCTGGCAGCAGCGGCTC

CATGACTCCCAGCACAAAG GGCTCAAAGGAGGCCGCATGAGCTTGGTGTTTGGGTGCCGGCACCCGGAGGAGGACCACCTCTATCAGGAAGAAATGCAG

GAGATGGTCCGCAAGAGAGTGCTGTTCCAGGTGCACACAGGCTACTCCCGGCTGCCCGGCAAACCCAAG GTCTACGTTCAGGACATCCTGCAAAAGCAG

CTGGCCAATGAGGTACTCAGCGTGCTCCACGGGGAGCAGGGCCACCTCTACATTTGCGGAGATGTGCGCATGGCTCGGGATGTGGCTACCACATTGAAGA

AGCTGGTGGCCACCAAGCTGAACTTGAGCGAGGAGCAGGTGGAAGACTATTTCTTCCAGCTCAAG AGCCAGAAACGTTATCATGAAGATATCTTCGGTG

CAGTCTTTTCCTATGGGGCAAAAAAGGGCAGCGCCTTGGAGGAGCCCAAAGCCACGAGGCTCTGACAGCCCAGAGTTCCAGCTTCTGGCACTGAGTAAAG

ATAATGGTGAGGGGCTTGGGGAGACAGCGAAATGCAATCCCCCCCAAGCCCCTCATGTCATTCCCCCCTCCTCCACCCTACCAAGTAGTATTGTACTATT

GTGGACTACTAAATCTCTCTCCTCTCCTCCCTCCCCTCTCTCCCTTTCCTCCCTTCTTCTCCACTCCCCAGCTCCCTCCTTCTCCTTCTCCTCCTTTGCC

TCTCACTCTTCCTTGGAGCTGAGAGCAGAGAAAAACTCAACCTCCTGACTGAAGCACTTTGGGTGACCACCAGGAGGCACCATGCCGCCGCTCTAATACT

TAGCTGCACTATGTACAGATATTTATACTTCATATTTAAGAAAACAGATACTTTTGTCTACTCCCAATGATGGCTTGGGCCTTTCCTGTATAATTCCTTG

ATGAAAAATATTTATATAAAATACATTTTATTTTAATC
Translation
 MACPWKFLFKVKSYQSDLKEEKDINNNVKKTPCAVLS SPTIQDDPKSHQNGSPQLLTGTAQ NVPESLDKLHVTSTRPQYVRIKNWGSGEILHDTLHH

KATS DFTCKSKSCLGSIMNPKSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKE - UNI33207 - EAKIEEHLARLEAVTKEIETTGTYQLTLDEL

IFATKMAWRNAPRCIGRIQWSNLQ VFDARNCSTAQEMFQHICRHILYATNNGNIR RSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAAT

LEFTQ LCIDLGWKPRYGRFDVLPLVLQADGQDPEVFEIPPDLVLEVTMEHPK KYEWFQELGLKWYALPAVANMLLEVGGLEFPACPFNGWYMGTEIGV

RDFCDTQRYNILE EVGRRMGLETHTLASLWKDRAVTEINVAVLHSFQ KQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQ

EMLNYVLSPFYYYQ IEPWKTHIWQNEKLRPRRREIRFRVLVK KVVFFASMLMRKVMASRVRATVLFATETGKSEALARDLATLFSYAFNTK VVCMDQ

YKASTLEEEQLLLVVTSTFGNGDCPSNGQ TLKKSLFMLRELNHTFR RYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGDELSGQEDAFRS

WAVQTFR AACETFDVRSKHHIQIPKRFTSNATWEPQQYRLIQSPEPLDLNRA ALSSIHAKNVFTMRLKSQQNLQSEKSS SRTTLLVQLTFEGSRGPS

YLPGEHLGIFPGNQTALVQGILERVVDCPTPHQTVCLEVLDESG GSYWVKDKRLPPCSLSQALTYFLDITTPPTQLQLHKLARFATDETDRQRLEALCQ

 PSEYNDWKFSNNPTFLEVLEEFPSLHVPAAFLLSQLPILKPRYYSISSSQDHTPSEVHLTVAVVTYRTRD DGQGPLHHGVCSTWIRNLKPQDPVPCFV

RS SVSGFQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDSQHKG GLKGGRMSLVFGCRHPEEDHLYQEEMQEMVRKRVLFQVHTGYSRLPGKPK VYV

QDILQKQLANEVLSVLHGEQGHLYICGDVRMARDVATTLKKLVATKLNLSEEQVEDYFFQLK SQKRYHEDIFGAVFSYGAKKGSALEEPKATRL

For any suggestions or comments, please send an email to unitrap@crg.es