Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020863 (3300001P08Rik)
Chromosomal location
Chr 11: 94152453 - 94183302 (-)
Description
RIKEN cDNA 3300001P08 gene Gene [Source:MGI Symbol;Acc:MGI:1914934]
RefSeq_dna
NM_026313 
RefSeq_peptide
NP_080589.1 
UniGene
Mm.30927 Mm.397729 
MGI
MGI:1914934 
Uniprot/SWISSPROT
Q5SUF2 
Human Ortholog
ENSG00000108848 (AC005921.3)
Omim not available
UniTrap UNI4963
Vector Insertion
Chr 11: 94171006 - 94183003
Public Clones AJ0032 (sanger) (sanger) RRG157 (baygenomics) FHCRC-GT-S19-7C1 (fhcrc) IST14677D5 (tigm)
IST12061F2 (tigm) IST14507D11 (tigm)
Private Clones OST465929 (lexicon) OST465067 (lexicon) OST450163 (lexicon) OST448648 (lexicon)
OST340643 (lexicon) OST288263 (lexicon) OST191417 (lexicon) OST191182 (lexicon)
OST137302 (lexicon) OST129794 (lexicon) OST129698 (lexicon) OST112932 (lexicon)
OST90614 (lexicon) OST60571 (lexicon) OST30419 (lexicon) OST23230 (lexicon)
OST21027 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25016
Vector Insertion
Chr 11: 94167540 - 94170938
Public Clones IST11696C8 (tigm) IST11696A8 (tigm)
Private Clones OST198104 (lexicon) OST31938 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23693
Vector Insertion
Chr 11: 94165301 - 94167499
Public Clones not available
Private Clones OST248907 (lexicon) OST240705 (lexicon) OST222731 (lexicon) OST191186 (lexicon)
OST76707 (lexicon) OST51119 (lexicon) OST51101 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20083
Vector Insertion
Chr 11: 94162894 - 94165155
Public Clones not available
Private Clones OST373438 (lexicon) OST277657 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5557
Vector Insertion
Chr 11: 94157395 - 94158197
Public Clones YTA105 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI49
Vector Insertion
Chr 11: 94154593 - 94157233
Public Clones GC0302 (tigem) XH046 (baygenomics) W012A08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107822
Sequence
GGAAGAGGCTTTTCGAGCTTGAGAGTGGGCCGAGGGGGCTTGGTTCGGCGGCCGGGCGGCTGGTGGGGTTTTTTATCGGGTGGGTGCTAGGGCTGGCGTG

AGCAGCCGCCCGGAGGAAGCACCATGATTTCTGCCGCGCAGTTGCTGGATGAGTTAATGGGCCGGGACCGAAACCTCGCCCCGGATGAGAAGCGCAGCAA

CGTGCGCTGGGACCACGAGAGC - UNI4963 - GTTTGTAAATATTATCTCTGCGGTTTTTGTCCTGCGGAATTGTTCACAAATACCCGTTCTGATCT

TG - UNI25016 - GTCCATGTGAAAAAATTCATGATGAAAATCTAAGAAAACA - UNI23693 - GTATGAGAAGAGTTCTCGCTTTATGAAAGT

TGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGTTTACTTGCCGAGGTAGAGCGCAGAATTAGACGAGGTCATGCTCGTTTGGCATTATCTCAAAAT

CAGCAGTCTTCTGGG - UNI20083 - GCTGCTGGTCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTGACAGACAAAATTGATGTGCTTCTACA

GCAG ATTGAAGAGTTAGGATCTGAAGGAAAGGTAGAAGAAGCCCAGGGAATGATGAAATTGGTTGAACAGTTAAAGGAAGAGAGAGAATTACTAAGATC

TACAACCTCG ACTATAGAAAGTTTTGCTGCCCAAGAAAAACAGATGGAAGTTTGTGAAGTGTGTGGAGCCTTTTTGATAGTAGGAGACGCCCAGTCCCG

AGTAGATGACCATCTGATGGGAAAGCAACACATGGGCTATGCCAAAATTAAAGCCACTGTGGAAGAATTAAAA GAAAAGTTAAGAAAAAGAACAGAGGA

ACCTGATCGGGATGAACGTCTCAAAAAAGAGAAGCAAGAAAGAGAGGAAAGAGAAAAAGAGCGGGAGAGAGAAAGAGAAGAACGGGAAAGAAAAAGACGA

AGAGAAGAGGAAGAAAGGGAAAAAGAAAGAGCTCGTGACAGAGAAAGGAGAAAGAGAAGTCGTTCACGGAGTAGACACTCAAGCCGAACTTCTGACCGGA

GATGCAGCAGGTCTCGGGACCACAAAAGATCACGGAGTAGAGACAGAAGGCGAAGCAG - UNI5557 - AAGTAGAGATCGACGAAGAAGCAGAAGCC

ATGACAGATCAGAAAGAAAACATAGATCTCGCAGTCGGGATCGAAGACGGTCAAAAAGCCGAGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGA

CAGAGAACAAGATAGAAAGTCCAAGGAGAAAG - UNI49 - AAAAGAAGGGATCTGATGATAAAAAGAGTAGTGTGAAGTCCAGTAGTCGAGAAAAGC

AGAGTGAAGACACAAACCCTGAATCGAAGGAAAGTGACACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAG TGCAGCGTAAGTATG

CACAGATGAAGATGGAGCTAAGCCGAGTAAGAAGACATACAAAAGCCTCTTCTGAAGGAAAAGACAGTGTAGTCCTGCAAAACATTTTGAG GACTACTG

TTGAAGAGTTTTTGAAGAATACTGAAAACGGAATAAAGTGA
Translation
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHES - UNI4963 - VCKYYLCGFCPAELFTNTRSDLG - UNI25016 - GPCEKIHDENLRKQ - 

UNI23693 - QYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSG - UNI20083 - AAGPTGKNEEKIQVLTDKIDVLLQQ 

IEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTS TIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELK EKLRKRTEE

PDRDERLKKEKQEREEREKEREREREERERKRRREEEEREKERARDRERRKRSRSRSRHSSRTSDRRCSRSRDHKRSRSRDRRRSR - UNI5557 - R

SRDRRRSRSHDRSERKHRSRSRDRRRSKSRDRKSYKHRSKSRDREQDRKSKEKE - UNI49 - EKKGSDDKKSSVKSSSREKQSEDTNPESKESDTKN

EVNGTSEDIKSEV VQRKYAQMKMELSRVRRHTKASSEGKDSVVLQNILR RTTVEEFLKNTENGIK
Transcript ENSMUST00000021226
Sequence
GGAAGAGGCTTTTCGAGCTTGAGAGTGGGCCGAGGGGGCTTGGTTCGGCGGCCGGGCGGCTGGTGGGGTTTTTTATCGGGTGGGTGCTAGGGCTGGCGTG

AGCAGCCGCCCGGAGGAAGCACCATGATTTCTGCCGCGCAGTTGCTGGATGAGTTAATGGGCCGGGACCGAAACCTCGCCCCGGATGAGAAGCGCAGCAA

CGTGCGCTGGGACCACGAGAGC - UNI4963 - GTTTGTAAATATTATCTCTGCGGTTTTTGTCCTGCGGAATTGTTCACAAATACCCGTTCTGATCT

TG - UNI25016 - GTCCATGTGAAAAAATTCATGATGAAAATCTAAGAAAACA - UNI23693 - GTATGAGAAGAGTTCTCGCTTTATGAAAGT

TGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGTTTACTTGCCGAGGTAGAGCGCAGAATTAGACGAGGTCATGCTCGTTTGGCATTATCTCAAAAT

CAGCAGTCTTCTGGG - UNI20083 - GCTGCTGGTCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTGACAGACAAAATTGATGTGCTTCTACA

GCAG ATTGAAGAGTTAGGATCTGAAGGAAAGGTAGAAGAAGCCCAGGGAATGATGAAATTGGTTGAACAGTTAAAGGAAGAGAGAGAATTACTAAGATC

TACAACCTCG ACTATAGAAAGTTTTGCTGCCCAAGAAAAACAGATGGAAGTTTGTGAAGTGTGTGGAGCCTTTTTGATAGTAGGAGACGCCCAGTCCCG

AGTAGATGACCATCTGATGGGAAAGCAACACATGGGCTATGCCAAAATTAAAGCCACTGTGGAAGAATTAAAA GAAAAGTTAAGAAAAAGAACAGAGGA

ACCTGATCGGGATGAACGTCTCAAAAAAGAGAAGCAAGAAAGAGAGGAAAGAGAAAAAGAGCGGGAGAGAGAAAGAGAAGAACGGGAAAGAAAAAGACGA

AGAGAAGAGGAAGAAAGGGAAAAAGAAAGAGCTCGTGACAGAGAAAGGAGAAAGAGAAGTCGTTCACGGAGTAGACACTCAAGCCGAACTTCTGACCGGA

GATGCAGCAGGTCTCGGGACCACAAAAGATCACGGAGTAGAGACAGAAGGCGAAGCAG - UNI5557 - AAGTAGAGATCGACGAAGAAGCAGAAGCC

ATGACAGATCAGAAAGAAAACATAGATCTCGCAGTCGGGATCGAAGACGGTCAAAAAGCCGAGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGA

CAGAGAACAAGATAGAAAGTCCAAGGAGAAAG - UNI49 - AAAAGAAGGGATCTGATGATAAAAAGAGTAGTGTGAAGTCCAGTAGTCGAGAAAAGC

AGAGTGAAGACACAAACCCTGAATCGAAGGAAAGTGACACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAG TGCAGCGTAAGTATG

CACAGATGAAGATGGAGCTAAGCCGAGTAAGAAGACATACAAAAGCCTCTTCTGAAGGAAAAGACAGTGTAGTCCTGCAAAACATTTTGAGGTACATTGT

TTTGTCTCAGCTATTTTGTAGCAGACTTCGTGCCCCCATTAGTGTGCCTCTTTGGAAATTACTGTCCACGTATGTAATATAGTCGCCATTGAAAAGTTAA

TTATCCTTTTTTTAGGGATTTTGCTGTCATTTCTTTTTCTTTTTCTTTTTTTTTTTAATAAAAAGGTTGAACTGTTTTTTTTTTCTTTTTGGTATTAAGT

CCATCTTGTGTTGGTACATTGGCAGAAACATATGCTTTAAAACTTAACTATTTCTGAGGCACATGTTGGACTACTTTGTTTTAATTAAACTGCTAGTATT

TATTTGTCCAGGATGTTTCTAGTTTTTTGCTTTATTGCCTTGCATTCTAATGCAGTTTGTTCTGTAACTCGAGAGCCAGTAGCATTGGATTGATGGAAGT

GTAGGGTTTATGAATTATTGCAGCTGACTACCATACCTCACACAGCGTTGGTGTTGTGAGCGGCCCATGAAAAGCCAAATTAGAAATCAAGGATTCAGTC

AAACTAAGCAGGTATTCATGCCAGGTACTCCTTTCTCTACCCACATCCGTGTTTGAATGCTATTGCCTGTGACCTTTACGCTTAACTGTTGTGTATCCTT

TTTGTTCTTTACAAGAAGCACAGAGGGGTTTTTTGTGTATTGCGTGAAATCTTACAAAGCCTATGTTAACAGAATGGAATTTTTTTTCAACTGTGTGTAG

GGATGCAGTGGTGCCCAGAATTAGATATCTTTAAAGAATTTTAAATACAATAAACACTTCATATTACCCGCCTTGTTACATTCAGTGCAATTCTCAAGTC

TTTAAGAGGTATGTGTTTAATGTTTCCTACTGTGTAGGAGAATTTGCAGTCAGCCATAGTATAGAGGAATAATCACTGGCTGAGACATCGAAAGCAACAG

CATCTAGCCAGGACAGACACTTGGATCAGTGACACAAAGAACTGATTGACTATCAGATGAGGTTGGGTTCTTAAAGAACTGTTTCAAGCTAGGTTTTATA

GATATTCTTAAAACCTCTAACTGTTCAATCTTCGGGCTAGTGGTGTGGGATGAAATATTCCTAATGAAAGGAAGTACCAATTAGTTGATTTATTGGTGGC

ATTCCTGTTTTAGAAAAGCAGTGTAGTTCTGTCTGTGTGAACCATTCACTCATAGGCAGCACACACAGGCACATGGCTCTAAGCACCACACTGATTGATT

GATGCCTTGATGTAAAAACAGTACATTTTATATACACGTGTCATGGTTAGCAGTTAGCGACTGGGCCAACACTTAGTCATAAAAGTTTACCTTTTATATG

CTGTCTAATTATCAATTTTCCCCAAATTTTGCATTGTAGGACTACTGTTGAAGAGTTTTTGAAGAATACTGAAAACGGAATAAAGTGAAGATCAACATTA

AAATGAGGTGAAAGAAAGCTATAGTGGCATAGAAAAAGTATAAAGCTCAGTTAGTTATTTGGTTTTTTTATTATTATTATTAAAAATTAATTCAGGACTG

TTGTGACCTACCAGATTTCAGAACATGTGTTAATAGCACATATGCCACTTTGAAAACTTAGGTCCTGTATCATATTTTTTCTTTAAGACTTTTTAAGAAA

TATTACCTAAACATGTGGCTTGCTCAGTGTTTACTTGCAAGTTTTCAGTCTTGGACTTTGAAGCCAGGATTCCACGTTAGTGCTCATGTGGAGCAGACTG

GGGCTCCGTTTTACACTTGTGCTCTCCTTAGCCTTTGGATTTAGAAGTGAAAATAAAGTATCTCTGACTTCCTGTTGC
Translation
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHES - UNI4963 - VCKYYLCGFCPAELFTNTRSDLG - UNI25016 - GPCEKIHDENLRKQ - 

UNI23693 - QYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSG - UNI20083 - AAGPTGKNEEKIQVLTDKIDVLLQQ 

IEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTS TIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELK EKLRKRTEE

PDRDERLKKEKQEREEREKEREREREERERKRRREEEEREKERARDRERRKRSRSRSRHSSRTSDRRCSRSRDHKRSRSRDRRRSR - UNI5557 - R

SRDRRRSRSHDRSERKHRSRSRDRRRSKSRDRKSYKHRSKSRDREQDRKSKEKE - UNI49 - EKKGSDDKKSSVKSSSREKQSEDTNPESKESDTKN

EVNGTSEDIKSEV VQRKYAQMKMELSRVRRHTKASSEGKDSVVLQNILRYIVLSQLFCSRLRAPISVPLWKLLSTYVI
Transcript ENSMUST00000107821
Sequence
AGGCGTGTCTCCACGGGCGCACGGCATGCTGGGAAGGTGCCCGGGCGGCGGCCATTTTGTCTTCTCGGCTCCTCTCTGGAAGAGGCTTTTCGAGCTTGAG

AGTGGGCCGAGGGGGCTTGGTTCGGCGGCCGGGCGGCTGGTGGGGTTTTTTATCGGGTGGGTGCTAGGGCTGGCGTGAGCAGCCGCCCGGAGGAAGCACC

ATGATTTCTGCCGCGCAGTTGCTGGATGAGTTAATGGGCCGGGACCGAAACCTCGCCCCGGATGAGAAGCGCAGCAACGTGCGCTGGGACCACGAGAGC 

- UNI4963 - GTTTGTAAATATTATCTCTGCGGTTTTTGTCCTGCGGAATTGTTCACAAATACCCGTTCTGATCTTG - UNI25016 - GTCCATG

TGAAAAAATTCATGATGAAAATCTAAGAAAACA - UNI23693 - GTATGAGAAGAGTTCTCGCTTTATGAAAGTTGGCTATGAGAGAGATTTTTTGC

GATACTTACAGAGTTTACTTGCCGAGGTAGAGCGCAGAATTAGACGAGGTCATGCTCGTTTGGCATTATCTCAAAATCAGCAGTCTTCTGGG - UNI20

083 - GCTGCTGGTCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTGACAGACAAAATTGATGTGCTTCTACAGCAG ATTGAAGAGTTAGGATCT

GAAGGAAAGGTAGAAGAAGCCCAGGGAATGATGAAATTGGTTGAACAGTTAAAGGAAGAGAGAGAATTACTAAGATCTACAACCTCG ACTATAGAAAGT

TTTGCTGCCCAAGAAAAACAGATGGAAGTTTGTGAAGTGTGTGGAGCCTTTTTGATAGTAGGAGACGCCCAGTCCCGAGTAGATGACCATCTGATGGGAA

AGCAACACATGGGCTATGCCAAAATTAAAGCCACTGTGGAAGAATTAAAA GAAAAGTTAAGAAAAAGAACAGAGGAACCTGATCGGGATGAACGTCTCA

AAAAAGAGAAGCAAGAAAGAGAGGAAAGAGAAAAAGAGCGGGAGAGAGAAAGAGAAGAACGGGAAAGAAAAAGACGAAGAGAAGAGGAAGAAAGGGAAAA

AGAAAGAGCTCGTGACAGAGAAAGGAGAAAGAGAAGTCGTTCACGGAGTAGACACTCAAGCCGAACTTCTGACCGGAGATGCAGCAGGTCTCGGGACCAC

AAAAGATCACGGAGTAGAGACAGAAGGCGAAGCAG - UNI5557 - AAGTAGAGATCGACGAAGAAGCAGAAGCCATGACAGATCAGAAAGAAAACAT

AGATCTCGCAGTCGGGATCGAAGACGGTCAAAAAGCCGAGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGACAGAGAACAAGATAGAAAGTCCA

AGGAGAAAG - UNI49 - AAAAGAAGGGATCTGATGATAAAAAGAGTAGTGTGAAGTCCAGTAGTCGAGAAAAGCAGAGTGAAGACACAAACCCTGAA

TCGAAGGAAAGTGACACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAGGTGACACTCAGTCCAATTAAAACTGATCTGATAAGACCT

CAGATCAGACAGAG GACTACTGTTGAAGAGTTTTTGAAGAATACTGAAAACGGAATAAAGTGAAGATCAACATTAAAATGAGGTGAAAGAAAGCTATAG

TGGCATAGAAAAAGTATAAAGCTCAGTTAGTTATTTGGTTTTTTTATTATTATTATTAAAAATTAATTCAGGACTGTTGTGACCTACCAGATTTCAGAAC

ATGTGTTAATAGCACATATGCCACTTTGAAAACTTAGGTCCTGTATCATATTTTTTCTTTAAGACTTTTTAAGAAATATTACCTAAACATGTGGCTTGCT

CAGTGTTTACTTGCAAGTTTTCAGTCTTGGACTTTGAAGCCAGGATTCCACGTTAGTGCTCATGTGGAGCAGACTGGGGCTCCGTTTTACACTTGTGCTC

TCCTTAGCCTTTGGATTTAGAAGTGAAAATAAAGTATCTCTGACTTCCTGTTGCA
Translation
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHES - UNI4963 - VCKYYLCGFCPAELFTNTRSDLG - UNI25016 - GPCEKIHDENLRKQ - 

UNI23693 - QYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSG - UNI20083 - AAGPTGKNEEKIQVLTDKIDVLLQQ 

IEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTS TIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELK EKLRKRTEE

PDRDERLKKEKQEREEREKEREREREERERKRRREEEEREKERARDRERRKRSRSRSRHSSRTSDRRCSRSRDHKRSRSRDRRRSR - UNI5557 - R

SRDRRRSRSHDRSERKHRSRSRDRRRSKSRDRKSYKHRSKSRDREQDRKSKEKE - UNI49 - EKKGSDDKKSSVKSSSREKQSEDTNPESKESDTKN

EVNGTSEDIKSEGDTQSN 
Transcript ENSMUST00000107820
Sequence
AGGCGTGTCTCCACGGGCGCACGGCATGCTGGGAAGGTGCCCGGGCGGCGGCCATTTTGTCTTCTCGGCTCCTCTCTGGAAGAGGCTTTTCGAGCTTGAG

AGTGGGCCGAGGGGGCTTGGTTCGGCGGCCGGGCGGCTGGTGGGGTTTTTTATCGGGTGGGTGCTAGGGCTGGCGTGAGCAGCCGCCCGGAGGAAGCACC

ATGATTTCTGCCGCGCAGTTGCTGGATGAGTTAATGGGCCGGGACCGAAACCTCGCCCCGGATGAGAAGCGCAGCAACGTGCGCTGGGACCACGAGAGC 

- UNI4963 - GTTTGTAAATATTATCTCTGCGGTTTTTGTCCTGCGGAATTGTTCACAAATACCCGTTCTGATCTTG - UNI25016 - GTCCATG

TGAAAAAATTCATGATGAAAATCTAAGAAAACA - UNI23693 - GTATGAGAAGAGTTCTCGCTTTATGAAAGTTGGCTATGAGAGAGATTTTTTGC

GATACTTACAGAGTTTACTTGCCGAGGTAGAGCGCAGAATTAGACGAGGTCATGCTCGTTTGGCATTATCTCAAAATCAGCAGTCTTCTGGG - UNI20

083 - GCTGCTGGTCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTGACAGACAAAATTGATGTGCTTCTACAGCAG ATTGAAGAGTTAGGATCT

GAAGGAAAGGTAGAAGAAGCCCAGGGAATGATGAAATTGGTTGAACAGTTAAAGGAAGAGAGAGAATTACTAAGATCTACAACCTCG ACTATAGAAAGT

TTTGCTGCCCAAGAAAAACAGATGGAAGTTTGTGAAGTGTGTGGAGCCTTTTTGATAGTAGGAGACGCCCAGTCCCGAGTAGATGACCATCTGATGGGAA

AGCAACACATGGGCTATGCCAAAATTAAAGCCACTGTGGAAGAATTAAAA GAAAAGTTAAGAAAAAGAACAGAGGAACCTGATCGGGATGAACGTCTCA

AAAAAGAGAAGCAAGAAAGAGAGGAAAGAGAAAAAGAGCGGGAGAGAGAAAGAGAAGAACGGGAAAGAAAAAGACGAAGAGAAGAGGAAGAAAGGGAAAA

AGAAAGAGCTCGTGACAGAGAAAGGAGAAAGAGAAGTCGTTCACGGAGTAGACACTCAAGCCGAACTTCTGACCGGAGATGCAGCAGGTCTCGGGACCAC

AAAAGATCACGGAGTAGAGACAGAAGGCGAAGCAG - UNI5557 - AAGTAGAGATCGACGAAGAAGCAGAAGCCATGACAGATCAGAAAGAAAACAT

AGATCTCGCAGTCGGGATCGAAGACGGTCAAAAAGCCGAGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGACAGAGAACAAGATAGAAAGTCCA

AGGAGAAAG - UNI49 - AAAAGAAGGGATCTGATGATAAAAAGAGTAGTGTGAAGTCCAGTAGTCGAGAAAAGCAGAGTGAAGACACAAACCCTGAA

TCGAAGGAAAGTGACACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAGGTGACACTCAGTCCAATTAAAACTGATCTGATAAGACCT

CAGATCAGACAGAGGTAAGTGTATTGTTTCTCACTTTGATTAGGGCTTTTTGTTACTGTTTGACAGTGCAGCGTAAGTATGCACAGATGAAGATGGAGCT

AAGCCGAGTAAGAAGACATACAAAAGCCTCTTCTGAAGGAAAAGACAGTGTAGTCCTGCAAAACATTTTGAGGTACATTGTTTTGTCTCAGCTATTTTGT

AGCAGACTTCGTGCCCCCATTAGTGTGCCTCTTTGGAAATTACTGTCCACGTATGTAATATAGTCGCCATTGAAAAGTTAATTATCCTTTTTTTAGGGAT

TTTGCTGTCATTTCTTTTTCTTTTTCTTTTTTTTTTTAATAAAAAGGTTGAACTGTTTTTTTTTTCTTTTTGGTATTAAGTCCATCTTGTGTTGGTACAT

TGGCAGAAACATATGCTTTAAAACTTAACTATTTCTGAGGCACATGTTGGACTACTTTGTTTTAATTAAACTGCTAGTATTTATTTGTCCAGGATGTTTC

TAGTTTTTTGCTTTATTGCCTTGCATTCTAATGCAGTTTGTTCTGTAACTCGAGAGCCAGTAGCATTGGATTGATGGAAGTGTAGGGTTTATGAATTATT

GCAGCTGACTACCATACCTCACACAGCGTTGGTGTTGTGAGCGGCCCATGAAAAGCCAAATTAGAAATCAAGGATTCAGTCAAACTAAGCAGGTATTCAT

GCCAGGTACTCCTTTCTCTACCCACATCCGTGTTTGAATGCTATTGCCTGTGACCTTTACGCTTAACTGTTGTGTATCCTTTTTGTTCTTTACAAGAAGC

ACAGAGGGGTTTTTTGTGTATTGCGTGAAATCTTACAAAGCCTATGTTAACAGAATGGAATTTTTTTTCAACTGTGTGTAGGGATGCAGTGGTGCCCAGA

ATTAGATATCTTTAAAGAATTTTAAATACAATAAACACTTCATATTACCCGCCTTGTTACATTCAGTGCAATTCTCAAGTCTTTAAGAGGTATGTGTTTA

ATGTTTCCTACTGTGTAGGAGAATTTGCAGTCAGCCATAGTATAGAGGAATAATCACTGGCTGAGACATCGAAAGCAACAGCATCTAGCCAGGACAGACA

CTTGGATCAGTGACACAAAGAACTGATTGACTATCAGATGAGGTTGGGTTCTTAAAGAACTGTTTCAAGCTAGGTTTTATAGATATTCTTAAAACCTCTA

ACTGTTCAATCTTCGGGCTAGTGGTGTGGGATGAAATATTCCTAATGAAAGGAAGTACCAATTAGTTGATTTATTGGTGGCATTCCTGTTTTAGAAAAGC

AGTGTAGTTCTGTCTGTGTGAACCATTCACTCATAGGCAGCACACACAGGCACATGGCTCTAAGCACCACACTGATTGATTGATGCCTTGATGTAAAAAC

AGTACATTTTATATACACGTGTCATGGTTAGCAGTTAGCGACTGGGCCAACACTTAGTCATAAAAGTTTACCTTTTATATGCTGTCTAATTATCAATTTT

CCCCAAATTTTGCATTGTAGGACTACTGTTGAAGAGTTTTTGAAGAATACTGAAAACGGAATAAAGTGAAGATCAACATTAAAATGAGGTGAAAGAAAGC

TATAGTGGCATAGAAAAAGTATAAAGCTCAGTTAGTTATTTGGTTTTTTTATTATTATTATTAAAAATTAATTCAGGACTGTTGTGACCTACCAGATTTC

AGAACATGTGTTAATAGCACATATGCCACTTTGAAAACTTAGGTCCTGTATCATATTTTTTCTTTAAGACTTTTTAAGAAATATTACCTAAACATGTGGC

TTGCTCAGTGTTTACTTGCAAGTTTTCAGTCTTGGACTTTGAAGCCAGGATTCCACGTTAGTGCTCATGTGGAGCAGACTGGGGCTCCGTTTTACACTTG

TGCTCTCCTTAGCCTTTGGATTTAGAAGTGAAAATAAAGTATCTCTGACTTCCTGTTGCA
Translation
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHES - UNI4963 - VCKYYLCGFCPAELFTNTRSDLG - UNI25016 - GPCEKIHDENLRKQ - 

UNI23693 - QYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSG - UNI20083 - AAGPTGKNEEKIQVLTDKIDVLLQQ 

IEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTS TIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELK EKLRKRTEE

PDRDERLKKEKQEREEREKEREREREERERKRRREEEEREKERARDRERRKRSRSRSRHSSRTSDRRCSRSRDHKRSRSRDRRRSR - UNI5557 - R

SRDRRRSRSHDRSERKHRSRSRDRRRSKSRDRKSYKHRSKSRDREQDRKSKEKE - UNI49 - EKKGSDDKKSSVKSSSREKQSEDTNPESKESDTKN

EVNGTSEDIKSEGDTQSN

For any suggestions or comments, please send an email to unitrap@crg.es