Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020888 (Dvl2)
Chromosomal location
Chr 11: 69814097 - 69825803 (+)
Description
dishevelled 2, dsh homolog (Drosophila) Gene [Source:MGI (curated);Acc:Dvl2-001]
RefSeq_dna
NM_007888 
RefSeq_peptide
NP_031914.3 
UniGene
Mm.5114 
MGI
MGI:106613 
Uniprot/SWISSPROT
Q60838 
Uniprot/SPTREMBL
Q3V330 Q569L9 Q7TN14 
Human Ortholog
ENSG00000004975 (DVL2)
Omim not available
UniTrap UNI929
Vector Insertion
Chr 11: 69818803 - 69818938
Public Clones BC0236 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15145
Vector Insertion
Chr 11: 69821446 - 69821521
Public Clones PST12239-NR (escells) PST8545-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9761
Vector Insertion
Chr 11: 69821963 - 69822278
Public Clones XG593 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9349
Vector Insertion
Chr 11: 69822645 - 69823612
Public Clones XH743 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000019362
Sequence
GCTGCTCGCGACGTCCGTGGAGCTAGTGGCCCTCGACTGTGCGGTCTAGGTTTTGAGTCTCGCCACACAGCTCTTCCCGATCAGCCCGCTGGTCCCCGCC

ATCCTCCTTGGGCACGTCTTCCGCACTGGCCCTGCGCTGTTGGCGCTAGCGCGTCAGTTTGCGGGTGTGCGCAGGCGCGGCGGGGGCGCTTAGTCCTGTT

GGGTGGGCGGCTGAGCCCGGGAGCGCGCGAGCGAGACCATGGCGGGCAGCAGCGCGGGGGGCGGTGGTGTAGGCGAGACGAAGGTGATTTACCATCTGGA

TGAAGAAGAGACTCCTTACCTGGTGAAGATCCCTGTCCCGGCGGAGCGCATCACGCTCGGCGATTTCAAGAGCGTTTTGCAGCGGCCCGCGGGCGCCAAG

TACTTTTTCAAGTCCATGGATCAGGATTTTGG GGTGGTGAAGGAAGAGATCTCCGATGACAATGCCCGCCTACCTTGCTTCAATGGAAGGGTTGTCTCC

TGG CTTGTGTCGTCAGATACCCCACAGCCTGAGGTGGCTCCCCCAGCCCATGAGTCTCGGACAGAACTGGTTCCTCCGCCTCCACCCTTACCCCCTTTG

CCACCAGAAAGGACCAGTGGAATTGGGGACTCAAGGCCTCCATCCTTCCA - UNI929 - CCCTAATGTATCCAGCAGCCATGAAAATCTAGAGCCTG

AGACAGAGACCGAATCTGTCGTATCACTGAGGCGAGACCGACCTAGGAGGAGAGACAGCAGTGAACATGGCG CTGGTGGCCACAGGCCTGGTGGCCCCT

CGAGGCTGGAGCGCCACCTGGCTGGCTACGAGAGCTCTTCCACCCTCATGACCAGTGAGCTGGAGAGTACCAGCCTAGGAGACTCGGATGAGGATGACAC

CATGAGTAG GTTCAGCAGCTCCACTGAGCAGAGCAGTGCCTCCCGCCTCCTCAAGCGCCACCGAAGGCGAAGGAAGCAGCGGCCGCCACGCATGGAGAG

G ACCTCATCCTTCAGCAGTGTCACCGATTCCACAATGTCTCTCAACATCATCACGGTCACGCTCAACATGG AGAAGTACAACTTCCTGGGCATCTCCA

TTGTGGGCCAAAGTAACGAGCGTGGTGATGGGGGCATCTACATCGGCTCCATCATGAAAGGGGGCGCGGTGGCTGCGGACGGGCGGATCGAGCCTGGAGA

CATGCTTTTGCAG GTAAATGATATGAACTTTGAGAACATGAGCAACGACGATGCTGTACGAGTGCTGAGAGACATCGTGCACAAGCCAGG CCCCATCG

TGCTGACCGTGGCCAAGTGTTGGGACCCGTCTCCCCAGGCCTACTTCACCCTCCCTCGAA ATGAGCCCATCCAGCCCATCGACCCAGCCGCCTGGGTGT

CGCACTCGGCTGCGCTGACTGGCGCCTTCCCTGCTTACCCTGGCTCCTCATCTATGAGCACTATCACATCTGGCTCCTCTCTGCCTGATG - UNI1514

5 - GCTGCGAAGGCCGGGGTCTCTCTGTCCACATGGACATGGCCTCTGTCACCAAGGCCATGGCAGCCCCAGAGTCTGGGCTCGAAGTCCGGGACCGCA

TGTGGCTCAAGATCACCATCCCAAACGCCTTTCTAG GCTCCGATGTGGTGGACTGGCTGTACCATCACGTGGAAGGTTTTCCTGAGCGCCGGGAGGCCC

GCAAGTATGCCAGTGGGCTGTTGAAGGCGGGACTCATCCGGCACACCGTCAACAAGATTACTTTCTCTGAGCAGTGCTATTATGTCTTCGGGGACCTCAG

TGGTGGCTGTGAGAGTT - UNI9761 - ACCTAGTTAACCTCTCTCTGAATGACAATGACGGTTCCAGTGGGGCTTCAGACCAGGATACCCTGGCACC

TCTGCCTGGAGCTACTCCCTGGCCCCTGCTGCCCACCTTCTCCTACCAGTATCCAGCGCCACACCCCTACAGCCCCCAGCCTCCACCCTACCACGAGCTT

TCTTCGTACACCTATGGTGGAGGCAGTGCCAGCAGCCAGCACAGTGAGG - UNI9349 - GGAGCCGGAGCAGCGGGTCGACAAGAAGCGATGGGGGG

GCTGGGCGCACAGGCAGGCCTGAGGAACGGGCCCCTGAGTCCAAGTCCGGCAGTGGCAGTGAGTCAGAACTCTCCAGCCGGGGAGGCAGCCTTCGGCGGG

GTGGGGAGCCTGGTGGGACTGGTGATGGCGGCCCTCCTCCATCCAGGGGCTCGACAGGCGCTCCTCCTAATCTCCGAGCTCTTCCCGGGCTCCATCCCTA

TGGAGCCCCATCTGGCATGGCTCTCCCCTATAACCCCATGATGGTAGTTATGATGCCTCCACCCCCACCCCCTGTCTCCACAGCAGTGCAGCCCCCTGGT

GCCCCTCCAGTCAGAGACCTGGGCTCCGTGCCCCCAGAACTGACAGCTAGCCGTCAGAGCTTCCACATGGCCATGGGCAACCCCAGTGAGTTTTTTGTGG

ATGTTATGTAGGGACCCATCTTGAGGCCACATTGGGTCTGTGCCCTTGGCCTGGCAAGTTTCAGCCTGGTGCCCTTCATAGTGCCTGGGCTCAGCCTGGC

GGCTGGTGCCTACCAAAACGTTTTTGCCACTGTGACTCTCACCAGCAGTGCCTGGTCCTTCCCCCTCTTCCTCGGGGGTAGATGGGGACCTTTGGTTATT

TTTAGCTTTATTTTTTATAAGCTTTTTGGGGGGTTAAAATAGACTTTCTTATATTTGGGGGAGTATTTTTTTAAATAGACAGTTCCTCTTTTATATGGAG

AATCCCTTCTAACCCCAGAATATGACCGCCACCTCCAGGTGCCTAGTCAGCTCTCATGTTGAGGGTGGGTGGTGGTCAGTGGTACCCTGGGAAGAAGAAG

GTGTGGGCTGGGTACCCCAGACAGCAGTCCAAGGAGGCTGGTGGTGTGTTGGGGACTGTGTAGCTGCCTTTGTTACTCTATTTATTTTAGTCACTTGTAC

AAAACACCAAATAAAGCAAATAGAGGCC
Translation
MAGSSAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFG GVVKEEISDDNARLPCFNGRVVSW LVSSDTPQP

EVAPPAHESRTELVPPPPPLPPLPPERTSGIGDSRPPSFH - UNI929 - HPNVSSSHENLEPETETESVVSLRRDRPRRRDSSEHGA AGGHRPGGP

SRLERHLAGYESSSTLMTSELESTSLGDSDEDDTMSR RFSSSTEQSSASRLLKRHRRRRKQRPPRMER TSSFSSVTDSTMSLNIITVTLNME EKYNF

LGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQ VNDMNFENMSNDDAVRVLRDIVHKPG GPIVLTVAKCWDPSPQAYFTLPRN NEPIQ

PIDPAAWVSHSAALTGAFPAYPGSSSMSTITSGSSLPDG - UNI15145 - GCEGRGLSVHMDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLG G

SDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESY - UNI9761 - YLVNLSLNDNDGSSGASDQDTLAPLPG

ATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEG - UNI9349 - GSRSSGSTRSDGGAGRTGRPEERAPESKSGSGSESELSSR

GGSLRRGGEPGGTGDGGPPPSRGSTGAPPNLRALPGLHPYGAPSGMALPYNPMMVVMMPPPPPPVSTAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGN

PSEFFVDVM
Transcript ENSMUST00000102575
Sequence
GCTGCTCGCGACGTCCGTGGAGCTAGTGGCCCTCGACTGTGCGGTCTAGGTTTTGAGTCTCGCCACACAGCTCTTCCCGATCAGCCCGCTGGTCCCCGCC

ATCCTCCTTGGGCACGTCTTCCGCACTGGCCCTGCGCTGTTGGCGCTAGCGCGTCAGTTTGCGGGTGTGCGCAGGCGCGGCGGGGGCGCTTAGTCCTGTT

GGGTGGGCGGCTGAGCCCGGGAGCGCGCGAGCGAGACCATGGCGGGCAGCAGCGCGGGGGGCGGTGGTGTAGGCGAGACGAAGGTGATTTACCATCTGGA

TGAAGAAGAGACTCCTTACCTGGTGAAGATCCCTGTCCCGGCGGAGCGCATCACGCTCGGCGATTTCAAGAGCGTTTTGCAGCGGCCCGCGGGCGCCAAG

TACTTTTTCAAGTCCATGGATCAGGATTTTGG GGTGGTGAAGGAAGAGATCTCCGATGACAATGCCCGCCTACCTTGCTTCAATGGAAGGGTTGTCTCC

TGG CTTGTGTCGTCAGATACCCCACAGCCTGAGGTGGCTCCCCCAGCCCATGAGTCTCGGACAGAACTGGTTCCTCCGCCTCCACCCTTACCCCCTTTG

CCACCAGAAAGGACCAGTGGAATTGGGGACTCAAGGCCTCCATCCTTCCA - UNI929 - CCCTAATGTATCCAGCAGCCATGAAAATCTAGAGCCTG

AGACAGAGACCGAATCTGTCGTATCACTGAGGCGAGACCGACCTAGGAGGAGAGACAGCAGTGAACATGGCG CTGGTGGCCACAGGCCTGGTGGCCCCT

CGAGGCTGGAGCGCCACCTGGCTGGCTACGAGAGCTCTTCCACCCTCATGACCAGTGAGCTGGAGAGTACCAGCCTAGGAGACTCGGATGAGGATGACAC

CATGAGTAG GTTCAGCAGCTCCACTGAGCAGAGCAGTGCCTCCCGCCTCCTCAAGCGCCACCGAAGGCGAAGGAAGCAGCGGCCGCCACGCATGGAGAG

G ACCTCATCCTTCAGCAGTGTCACCGATTCCACAATGTCTCTCAACATCATCACGGTCACGCTCAACATGG AGAAGTACAACTTCCTGGGCATCTCCA

TTGTGGGCCAAAGTAACGAGCGTGGTGATGGGGGCATCTACATCGGCTCCATCATGAAAGGGGGCGCGGTGGCTGCGGACGGGCGGATCGAGCCTGGAGA

CATGCTTTTGCAG GTAAATGATATGAACTTTGAGAACATGAGCAACGACGATGCTGTACGAGTGCTGAGAGACATCGTGCACAAGCCAGG CCCCATCG

TGCTGACCGTGGCCAAGTGTTGGGACCCGTCTCCCCAGGCCTACTTCACCCTCCCTCGAA ATGAGCCCATCCAGCCCATCGACCCAGCCGCCTGGGTGT

CGCACTCGGCTGCGCTGACTGGCGCCTTCCCTGCTTACCCTGGCTCCTCATCTATGAGCACTATCACATCTGGCTCCTCTCTGCCTGATG - UNI1514

5 - GCTGCGAAGGCCGGGGTCTCTCTGTCCACATGGACATGGCCTCTGTCACCAAGGCCATGGCAGCCCCAGAGTCTGGGCTCGAAGTCCGGGACCGCA

TGTGGCTCAAGATCACCATCCCAAACGCCTTTCTAG GCTCCGATGTGGTGGACTGGCTGTACCATCACGTGGAAGGTTTTCCTGAGCGCCGGGAGGCCC

GCAAGTATGCCAGTGGGCTGTTGAAGGCGGGACTCATCCGGCACACCGTCAACAAGATTACTTTCTCTGAGCAGTGCTATTATGTCTTCGGGGACCTCAG

TGGTGGCTGTGAGAGTT - UNI9761 - ACCTAGTTAACCTCTCTCTGAATGACAATGACGGTTCCAGTGGGGCTTCAGACCAGGATACCCTGGCACC

TCTGCCTGGAGCTACTCCCTGGCCCCTGCTGCCCACCTTCTCCTACCAGTATCCAGCGCCACACCCCTACAGCCCCCAGCCTCCACCCTACCACGAGCTT

TCTTCGTACACCTATGGTGGAGGCAGTGCCAGCAGCCAGCACAGTGAGG - UNI9349 - GGAGCCGGAGCAGCGGGTCGACAAGAAGCGATGGGGGG

GCTGGGCGCACAGGCAGGCCTGAGGAACGGGCCCCTGAGTCCAAGTCCGGCAGTGGCAGTGAGTCAGAACTCTCCAGCCGGGGAGGCAGCCTTCGGCGGG

GTGGGGAGCCTGGTGGGACTGGTGATGGCGGCCCTCCTCCATCCAGGGGCTCGACAGGCGCTCCTCCTAATCTCCGAGCTCTTCCCGGGCTCCATCCCTA

TGGAGCCCCATCTGGCATGGCTCTCCCCTATAACCCCATGATGGTAGTTATGATGCCTCCACCCCCACCCCCTGTCTCCACAGCAGTGCAGCCCCCTGGT

GCCCCTCCAGTCAGAGACCTGGGCTCCGTGCCCCCAGAACTGACAGCTAGCCGTCAGAGCTTCCACATGGCCATGGGCAACCCCAGTGAGTTTTTTGTGG

ATGTTATGTAGGGACCCATCTTGAGGCCACATTGGGTCTGTGCCCTTGGCCTGGCAAGTTTCAGCCTGGTGCCCTTCATAGTGCCTGGGCTCAGCCTGGC

GGCTGGTGCCTACCAAAACGTTTTTGCCACTGTGACTCTCACCAGCAGTGCCTGGTCCTTCCCCCTCTTCCTCGGGGGTAGATGGGGACCTTTGGTTATT

TTTAGCTTTATTTTTTATAAGCTTTTTGGGGGGTTAAAATAGACTTTCTTATATTTGGGGGAGTATTTTTTTAAATAGACAGTTCCTCTTTTATATGGAG

AATCCCTTCTAACCCCAGAATATGACCGCCACCTCCAGGTGCCTAGTCAGCTCTCATGTTGAGGGTGGGTGGTGGTCAGTGGTACCCTGGGAAGAAGAAG

GTGTGGGCTGGGTACCCCAGACAGCAGTCCAAGGAGGCTGGTGGTGTGTTGGGGACTGTGTAGCTGCCTTTGTTACTCTATTTATTTTAGTCACTTGTAC

AAAACACCAAATAAAGCAAATAGAGGCCAACTCCCCAAGCCTCTGGCTCCTTTCTTTGCGAGGCAGGCAGTGGAGAGGAGGGAGCAGTGACATTCACGGC

AGACAGTGACTTGGTAGAAAATTTATTGTTAAGGCAATAAGTACTCCATCACCCCCATAAAGGGTTTTGGCATCAGAGAAGGCACATGACCTTGCCAGGG

CCTGATTGGGAGTCTCAGATTCCCAGGGGGTTACCGGTGACCAGGCCACCATTCTCCACCATGGCCTTGGAGATGCTTCTGAAGTTCCGGAAGAGCTCCT

GATGCTGAGGGCTGGACTGCAGACTGGCCATGTTTTCTCGGATCCGAGTTGCAGCCTGGGGAGAGGGAAGGGGAGGGACGGTCAGGCCGTCCTGTACTGG

GGAGCTCCAAGGCCCACCTGTACTGGGGAGCTCCAAGGCTCACCTCAATGCACCAGCTATCACAGAGCATTTTCTCATGCTGTGCCGTCGGGTAGCCCTC

ACTCAGGGACCTTGAGGCTCTGTGAGGAAACAGAGGTTAAAATGATCCTGAGTGCTGGTGTTGGCCCAGCTCCTCTGTGGCTCTAGCCTGCCAAGCGTCC

CTCGCTGCCGCCTTACCTGGACAGAACCACCACCATGGCATAGAGGTCAATGGCGCCGTCCGCCAGTCGCTGCAGCAGGAACTGCTCGTCTGTCAG CTT

GGCCTCCACCACGGTGGCAAATTGATCCAGAGCCTGCACTGCCTGAAGAGACAAGAGTCACAGACAGAGCTCAGGAGAGGAAGGCAGCGCACAGCCACCG

CAGGCTCTGCTTTAAGGCTCACTCACCAGTTCACCACTGCGACTTAACTCTGGGTGGACAATCCCTGACAGACTCAAACCACTGCCGATTCCTGTCCTCC

TGAGAGGAGATGGAAGAGTGACTGGTCAGTTGCGGCCTCCCATCTTGTTTGACCCTGACTCTGACCCTGGCCCCGGCCCATGAGGTACCGTCTCAGCTGT

TTGCCTGCTTCTCCCATCAGGAGGCCAACGTTTCCAAAAGGATTCTTCAGGGCATTGCCCAGCCCAGTGAGTTCCTTTCCTTTGTCCTGTGGAGAGAAGG

GGGACGGCGACAGTGAGGACTCAGTGTCCTCCCCAGCTGCTCTCTCTCATCCTCCTTCCTCTTACCATACAGCCTTGCAGAGCCACAAACAGTCGAAGAA

TGTCATTTGCCCCTTCAAAGATCCGGAAGATTCGAATATCTCGGAGCACACGCTCCACCCCTGGTTCCTGGCACGCAGGAAGACACAGAAACCTCTGTTG

AGATGTGCCTGTCCACTCTGAACAGATGCCCCCCCCTGCCGAGGAATACTCTGTACCTTCATGAAGCCCATGCCCCCCATTATTTGGATGCACTCATCTG

CCACTTTCCAGGCCGCCTCCTGAGGACAGAGAACCAGATGAGTTGGATTTTTGAGCTGAGGTCCTAATCTGGACTCCGCCCTCCCATCACACCTGGGTCC

TCACCGAGCAAAAGATTTTGCTGATGGCGGCTTCTATCTGGAAGTCTTTGAATCCCTGGTCCATGTTGGCACTCAGCATGTAAGCCATGGACTAAGGGAG

CATGGTCGGGACATGGGGAAGACAACAGGGAAGGGCTGCATCAGACAGAATGGCTAATGCTCAGACCTTCAAGACCAGTGCTGATCTACTCCTCCAACCC

TTGAATTCACTTTAGCCTCCTGGTCAGGTCAAATATGTCCAATATGTGACCCTCTGGTATATCAGGGGCTTCGAGGCTTCCGACTTTGTAAAGGGGTGGG

TTAAAAGTCGTGTTTGGTGCATCTGGGCAGCATTTAGCAGAGCAGCACCACCCTCCAGAAGAGAACTGACTATGCCTCCTCGCATCCCCTAGGGCATTGG

TGTAAAGCTGGAGACCCACTGCCCCAGGTGCTGCTGGGGGTTGTAGTCTGACCCAACTGTGAAGAAAGCCATAGGGCTCCAGGGAAGGGGCCCAGGAGGC

CCTTACCTCAGTCACATACTGCAGAATAGCCATCCGAGCCAGCTTTTCCTGGATCACCCCAAAGTTGTGAATTTTGTCCCCAAACTGGGTACGATTAGTA

GCATGATCAACCTGCAAGAGGG
Translation
MAGSSAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFG GVVKEEISDDNARLPCFNGRVVSW LVSSDTPQP

EVAPPAHESRTELVPPPPPLPPLPPERTSGIGDSRPPSFH - UNI929 - HPNVSSSHENLEPETETESVVSLRRDRPRRRDSSEHGA AGGHRPGGP

SRLERHLAGYESSSTLMTSELESTSLGDSDEDDTMSR RFSSSTEQSSASRLLKRHRRRRKQRPPRMER TSSFSSVTDSTMSLNIITVTLNME EKYNF

LGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQ VNDMNFENMSNDDAVRVLRDIVHKPG GPIVLTVAKCWDPSPQAYFTLPRN NEPIQ

PIDPAAWVSHSAALTGAFPAYPGSSSMSTITSGSSLPDG - UNI15145 - GCEGRGLSVHMDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLG G

SDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESY - UNI9761 - YLVNLSLNDNDGSSGASDQDTLAPLPG

ATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEG - UNI9349 - GSRSSGSTRSDGGAGRTGRPEERAPESKSGSGSESELSSR

GGSLRRGGEPGGTGDGGPPPSRGSTGAPPNLRALPGLHPYGAPSGMALPYNPMMVVMMPPPPPPVSTAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGN

PSEFFVDVM 

For any suggestions or comments, please send an email to unitrap@crg.es