Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020895 (Tmem107)
Chromosomal location
Chr 11: 68884311 - 68886794 (+)
Description
transmembrane protein 107 Gene [Source:MGI (curated);Acc:Tmem107-002]
RefSeq_dna
NM_025838 NM_028336 
RefSeq_peptide
NP_080114.1 NP_082612.1 
UniGene
Mm.33964 
MGI
MGI:1914160 
Uniprot/SWISSPROT
Q9CPV0 
Uniprot/SPTREMBL
B2RPS9 
Human Ortholog
ENSG00000179029 (TMEM107)
Omim not available
UniTrap UNI23625
Vector Insertion
Chr 11: 68884794 - 68884875
Public Clones not available
Private Clones OST251129 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32888
Vector Insertion
Chr 11: 68885924 - 68886529
Public Clones IST13842H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23732
Vector Insertion
Chr 11: 68886022 - 68886247
Public Clones IST12051A5 (tigm) IST13842H4 (tigm) IST14176H5 (tigm)
Private Clones OST246561 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000075980
Sequence
GGGCGGCGCCCGAGCGCGCGGGAAGGACACTTAAGTAGAGAGGTCTGGCCTGCTTGCTCAGGGAGACTTGATGAGTGACCCACCCCAGACTTCCAACCTC

AAAACCCACGGCCTCCACTCGAGGCCCCCGAGGCCATGGGTCGGATCTCCGGGCTCGTGCCCTCTCGGTTCCTGACGCTCTTGGCTCATCTGGTGGTTGT

CATCACGTTGTTCTGGTCCCGG GAAAGCAACATCCAGGCTTGCCTGCCTCTCAAATTCACCCCGGAGGAATACGAAAAGCAGGACAACCA - UNI236

25 - GCTGGTAGCCGCGCTCTGTCTCACCCTGGGCCTCTTTGCAGTGGAGCTGGCTGGCTTCCTCTCAGGAGTCTCCATGTTCAATAGCACCCAGAGCC

TCCTCT - UNI32888 - CCATTGCAGCCCACTGTAGCGCGTCTGTGGCCCTGTCTTTCTTCGTATTCGAGCGATGGGAATGTACCACGTACTGGTAC

ATTTTTACCTTCTGCAG - UNI23732 - - UNI32888 - CGCCTTCCCAGCTGTCACTGAAACTGCATTATTCATCGCTGTCTTTGGGCTGAAAA

AGAAACCCTTCTGATCACAATCCGGGTGTAGGGACCAAGGCTGGAAAAGTGATGAAGCTTCCTCCCACTGCTGCAAGAAAAAGGCAGAGGCTTCAGTTTT

CTCTCGCCCAAGTCCCTTGCTCCTCCCAACTGCGGCTAAGCAGAGGATGGCAGTGTTGGAATAAGATCTCTCAAATCTTGGATTATAATTTTATTAGAGT

TTTGTAATAAAATTTATTTTATAAC
Translation
MGRISGLVPSRFLTLLAHLVVVITLFWSR ESNIQACLPLKFTPEEYEKQDNQ - UNI23625 - QLVAALCLTLGLFAVELAGFLSGVSMFNSTQSL

LS - UNI32888 - SIAAHCSASVALSFFVFERWECTTYWYIFTFCS - UNI23732 - - UNI32888 - SAFPAVTETALFIAVFGLKKKPF
Transcript ENSMUST00000094081
Sequence
GCCGGGCGGCGCCCGAGCGCGCGGGAAGGACACTTAAGTAGAGAGGTCTGGCCTGCTTGCTCAGGGAGACTTGATGAGTGACCCACCCCAGACTTCCAAC

CTCAAAACCCACGGCCTCCACTCGAGGCCCCCGAGGCCATGGGTCGGATCTCCGGGCTCGTGCCCTCTCGGTTCCTGACGCTCTTGGCTCATCTGGTGGT

TGTCATCACGTTGTTCTGGTCCCGG GAAAGCAACATCCAGGCTTGCCTGCCTCTCAAATTCACCCCGGAGGAATACGAAAAGCAGGACAACCA - UNI

23625 - GCTGGTAGCCGCGCTCTGTCTCACCCTGGGCCTCTTTGCAGTGGAGCTGGCTGGCTTCCTCTCAGGAGTCTCCATGTTCAATAGCACCCAGA

GCCTCCTCT - UNI32888 - CCATTGCAGCCCACTGTAGCGCGTCTGTGGCCCTGTCTTTCTTCGTATTCGAGCGATGGGAATGTACCACGTACTGG

TACATTTTTACCTTCTGCAGGTGCCCTAGCACCCAATATTTTGGAATGGGGGGGGGTGGTGGAAAATCGATCCCAAATCTGAAGGTTTCCCCCACCTAGA

CCTTTCCTGCACATGTGAAATTGGTAGAGTTTTGAAGAGTCATACCCACCCTAACCCACCCGCATATAAGGTTTGGAGGTTCAAGTGTTTGGGTTGGAAG

GGGCTCTAACTCCCCCCCCTCCCCCGCGGCCCCGTACTTTTCACAGCGCCTTCCCAGCTGTCACTGAAACTGCATTATTCATCGCTGTCTTTGGGCTGAA

AAAGAAACCCTTCTGATCACAATCCGGGTGTAGGGACCAAGGCTGGAAAAGTGATGAAGCTTCCTCCCACTGCTGCAAGAAAAAGGCAGAGGCTTCAGTT

TTCTCTCGCCCAAGTCCCTTGCTCCTCCCAACTGCGGCTAAGCAGAGGATGGCAGTGTTGGAATAAGATCTCTCAAATCTTGGATTATAATTTTATTAGA

GTTTTGTAATAAAATTTATTTTATAACAAGAGCAAGGCGTATACTATTTTTCAGAAGACCATTGGATGGGCCAAGAGGCTGGTATAAATAAAGGCTTTTA

TCTTGTGGTTAGGGCTAGAAGTAATGCTTCTATTTGGGTTTTTACGCTAGAAGCTAGGCGGAAGTGAGTGGGCGGGGATATGCAAATAACTATCTCACAT

AGCGCTTCTAATTTGCCGCGTGTGAGGGGAGCATTCTGGGATGGTTTTGTTTCTCCCTTTTTGTGCCGAATGGAGAATAAAATACTTCAAACG
Translation
MGRISGLVPSRFLTLLAHLVVVITLFWSR ESNIQACLPLKFTPEEYEKQDNQ - UNI23625 - QLVAALCLTLGLFAVELAGFLSGVSMFNSTQSL

LS - UNI32888 - SIAAHCSASVALSFFVFERWECTTYWYIFTFCRCPSTQYFGMGGGGGKSIPNLKVSPT

For any suggestions or comments, please send an email to unitrap@crg.es