Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000020935 (Dcakd)
Chromosomal location
Chr 11: 102855370 - 102878461 (-)
Description
dephospho-CoA kinase domain containing Gene [Source:MGI (curated);Acc:Dcakd-001]
RefSeq_dna
NM_026551 
RefSeq_peptide
NP_080827.2 
MGI
MGI:1915337 
Uniprot/SWISSPROT
Q8BHC4 
Uniprot/SPTREMBL
B0QZX9 
Human Ortholog
ENSG00000172992 (DCAKD)
Omim not available
UniTrap UNI6241
Vector Insertion
Chr 11: 102861671 - 102878363
Public Clones CSG499 (baygenomics) (ggtc) D102H03 (ggtc) CMHD-GT_472B5-3 (cmhd) IST14012E5 (tigm)
IST14509H7 (tigm) IST14516D12 (tigm)
Private Clones OST421133 (lexicon) OST419046 (lexicon) OST330222 (lexicon) OST293476 (lexicon)
OST272846 (lexicon) OST270284 (lexicon) OST252027 (lexicon) OST230216 (lexicon)
OST186560 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19400
Vector Insertion
Chr 11: 102861162 - 102861463
Public Clones not available
Private Clones OST392008 (lexicon) OST311608 (lexicon) OST302417 (lexicon) OST223092 (lexicon)
OST193111 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021313
Sequence
GTGCACGCTCCCGAGTCCCGCCTGTGTGCAGCGAGCCAGCCAGTAAGCGCAGCGGAGATTGGGCTAGCGACGGAGGCTGAGGCCGAGTCGGAGACCCG -

 UNI6241 - GATTTCCCAGCCTGGTGGAGCAGCCGACTGGCGAGTGTGCCAACTGTCCCGTGCTTCCCAGCTCCTACCTTGCCTGTCTTCTCTCTCCT

GGGAAGATGTTCCTGGTGGGGCTGACGGGAGGCATCGCCTCAGGCAAGAGCTCCGTCATCCAGGTATTCCAACAGCTGGGCTGTGCTGTAATCGACGTGG

ACGTCATTGCGCGGCACG - UNI19400 - TTGTCCAGCCAGGGTATCCTGCCCACCGGCGTATAGTAGAGGCCTTTGGCACTGAAGTCTTGCTGGAG

AATGGCGACATCGACCGCAAGGTCCTCGGAGACCTGATCTTCAACCAGCCTGACCGTCGGCAGCTGCTCAACTCCATTACCCACCCTGAGATCCGCAAGG

AAATGATGAAGGAGACCTTCAAGTACTTTCTCCGAG GCTACCGATACGTGATTCTGGACATCCCCCTCCTGTTTGAGACCAAGAAGCTGCTCAAGTATA

TGAAGCACACAGTGGTAGTGTACTG TGACCGTGATACACAGCTGGCGCGGCTGATGAAGCGGAACAACCTGAACCGGGAGGATGCAGAGGCGAGGATCA

ACGCCCAGCTGCCCCTGAAGGACAAGGCCCGCATGGCCAATCACGTTCTGGACAACTCGGGCGAGTGGAGCCTCACCAGACGCCAGGCCATCCTCCTGCA

CGCCAAGCTGGAACGCTCCATGGAGTATCTGCCGCTGCGGCTTGGGTTCCTGACGGGCCTCGCAGGCATCGCCAGTCTCCTCTACCTGCTCACCCGTTAC

CTCCTCCCTTCCCCCTAGCTGGGTACACCCAGGCAGCAAGCCTTAGGCTTCCTTCTCCTTGGAGGCCTGAGTTAGGTACCATGTCCACAACACTACAACT

CTCTTGACTCTGAGACTGGCCCCTGCGGTGGGGCGGCTTTGGAGTGTAACCAGTCTGGGACTCAGCAAAAGAAGCCCACTACCCCCCGCGCCCCACACAC

ACACACCGACACCCCACCCCACCCGAGCCCTACCATTCCTAACTACCACTGCAGAACAACATCCATGGTGGCAGGAAACCAGCGGTTAGCAGGCTCTGCG

GCTCTCCCTATGGTTACGACTGTGTAGCCAAAAGTGTCTTGGGCTTGAACCTTTCCAGAGCATCTGCCGCATCATGGCCACAAGCTGTCTAGTGGACCAC

AGCAAATCCTTCCAGACTGAAGGCCTCCTTCAAATAGAGCTCTCCTGTGTGCAGTGTGGTTCTCCTCCTGGGCGTGCCGTGGCTGGGTCGAGCAGAGCCC

TTTGGAGCAGTCCAGCTTCTGATGGAGCTTTCCTCACAGCTAGCCACCACCCCGTGCTCTCGGCATTCCCCAGGCCCCAAGCTCTCCTACCTCTGTGCCT

TCCCCACATGCTCCCTGCCCTGCAGTATCTTACCCCTGGCTGCCCCAGGTCAGGCTCCAGCAGCCCCAGACTGAGTTAGGTGCTATAGAGATCACCTTCC

TGTCTCATCCAAATCCACGAGAGAATAACGCGTAACCTGGTTGGGTTCTCCCAGACTGTACGCCTCTAGATGGCAGGGCCGATTCATCTCCACTCTAGTG

TACCACAGCCTGCCCCACAGGTGCTCAATAAATGGAATTGCTC
Translation
 - UNI6241 - MFLVGLTGGIASGKSSVIQVFQQLGCAVIDVDVIARHV - UNI19400 - VVQPGYPAHRRIVEAFGTEVLLENGDIDRKVLGDL

IFNQPDRRQLLNSITHPEIRKEMMKETFKYFLRG GYRYVILDIPLLFETKKLLKYMKHTVVVYC CDRDTQLARLMKRNNLNREDAEARINAQLPLKDK

ARMANHVLDNSGEWSLTRRQAILLHAKLERSMEYLPLRLGFLTGLAGIASLLYLLTRYLLPSP

For any suggestions or comments, please send an email to unitrap@crg.es