Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021044 (Adck1)
Chromosomal location
Chr 12: 89598998 - 89700163 (+)
Description
aarF domain containing kinase 1 Gene [Source:MGI Symbol;Acc:MGI:1919363]
RefSeq_dna
NM_028105 
RefSeq_peptide
NP_082381.1 
MGI
MGI:1919363 
Uniprot/SWISSPROT
Q9D0L4 
Human Ortholog
ENSG00000063761 (ADCK1)
Omim not available
UniTrap UNI31500
Vector Insertion
Chr 12: 89685202 - 89693922
Public Clones IST14132A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101165
Sequence
ATTTGGGTTCCGGGCTGCGCGGCGCAGCTTCCCTACCCTCTG GGTCTGGAGACATGGCCAGAAAGGCTCTCAAGCTTGCTTCATGGACCAGCGTGGCTC

TTGCTGCCTCCGGTGTCTACCTCTACAGTAACAACTACTTGGACCCTAATGACTTTGGCGCTGTCAGGGTGGGCAGAGCTGTTGCTACG ACAGCTGTCA

TCAGCTATGACTACCTCACCTCCCTGAGGAGTGTCCCATATGGCTCTGAGGAGTATTTGCAGCGTCGATCCCAG GTGCACCTCCGCTCTGCCAGGCGTC

TCTTTGAGCTCTGCTGTGCCAACCGGGGCACTTTCATCAAGGTGGGCCAGCACCTGGGGGCGCTGGACTACCTGCTGCCAGAAGAGTACACCAGCACACT

GAAGGTGTTGCACAGTCAAGCCCCACAGAGCAGCATGCAAGAGGTCCGGCAGGTCATCCGAGAAGACCTGGGCAAGGAG ATCCACGATTTGTTCCTGAG

CTTCGATGACACCCCTCTTGGGGCAGCCTCCCTGGCCCAGGTCCACAAGGCGGTGTTGCATGATGGTCGGACAGTGGCAGTTAAGGTCCAGCACCCGAAG

GTTCAGGCTCAAAGCTCTAAGGACATTCTCCTGATGGAG GTGCTTGTCCTGGCCGTGAAGCAACTTTTCCCAGATTTTGAATTCATGTGGCTGGTGGAT

GAAGCGAAGAAGAACCTGCCTCTCGAGTTGGACTTCCTGAATGAAGGGAGGAACGCTGAGAAAGTGGCCCACATGCTCAGGCACTTTGACTTCCTAAAG 

GTTCCCCAGATCCACTGGGAGCTGTCTACCAAGAGGGTGCTCCTGATGGAATTTGTAGAGGGAGGTCAAGTCAACGACAGGGCCTACATGGAGAAGAACC

AGATCGATGTGAATGAG - UNI31500 - ATCTCCTGCCACCTGGGCAAGATGTACAGTGAGATGATCTTTGTCAATGGCTTCGTGCACTGTGACCCC

CACCCAGGCAACGTACTGGTACGGAAGCGTCCTGACACGGGCAAGGCTGAGATTGTCCTCTTAGACCATGGGCTTTACCAG GTGCTCACGGAGGAGTTC

CGCCTGGACTACTGCCATCTGTGGCAGTCTCTGATCTGGACTGACATGGACGGGCTGAAACAGTACAGCCAGCGCCTGGGAGCTGCAGACCTCTACCCAC

TGTTTGCCTGTATGCTGACAGCCCGGTCCTGGGACTCAGTCAAACAGGGCATTGGGCAAGCTCCAGTCTCTGCTACTGAG GACTCAGAGATTCGCAATA

ATGCAGCCTGCTACCTGCCTGAGATCAGCCAGCTCCTTAACCATGTGCCTCGCCAGATGCTGCTCATCCTGAAGACTAATGATCTACTCCGTAGCATTGA

GACCACCCTGGGCACGCGCTCCAGTGCCAGTTCCTTCCTCAACATGTCTCGGTGTTGTATCAGGGCGCTGGCTGA ACACAAGAAGAGGGATGCCGGCTC

TTTCTTCAGAAGGACTCAGATATCTTTCAGTGAGGCCTTTAGCCTGTGGCAGATCAACCTTCATGAACTTCTGCTTCGAGTGAGGGCCTTGAGGCTAGCT

TGCTGGGTCTCAGCTCTCCTGGGCTGGCTGACTCGGGCTCCACACAGAATGTGATGGTCTTTCCCTGCCCCTTCGTAGTGTCTTTCCACACCTCATTCCT

TCCTTCACGCTGGGACGACCCACTGACCCATGGCTGCCTAGGGTTGGCTGTGGTCCCAGAGTGGTCATCCATGGCACCCTCATGCTCTGCCATTGGAGCC

CCTGCCTTGGGGTGGCCTTGTCTTGAGGTCCTGGAATGTCCTGGAGAGTGAGATGGGATAAAGCAACCTCTCTCCCATCTCCTGTGTGTGCCATTGACTT

GGTCATCCCTACTTTTATGAGGACTGTGAGAATGGACCAACCACCTGTGTCACAGGGGCGTGTTTAACTTGTAGGGAATAAGTAGAAACTCAGAACCTGC

AGAGAACAGACTTTATATTTTTGCTGTATCACTCCCAAAGTTGTCTCGCCTCAGTGAGGAAGACTGCATCTGAGAGGGAACGATGCAACTGTGGGCTCAT

GCTGTCATGGTGACACCTTCAGTGTTATATGTATTGTATATATTGTTTATTGTAATAAACCAATAAACAGTTTCAAGGTTG
Translation
 MARKALKLASWTSVALAASGVYLYSNNYLDPNDFGAVRVGRAVAT TAVISYDYLTSLRSVPYGSEEYLQRRSQ VHLRSARRLFELCCANRGTFIKVG

QHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEVRQVIREDLGKE IHDLFLSFDDTPLGAASLAQVHKAVLHDGRTVAVKVQHPKVQAQSSKDILLME V

LVLAVKQLFPDFEFMWLVDEAKKNLPLELDFLNEGRNAEKVAHMLRHFDFLK VPQIHWELSTKRVLLMEFVEGGQVNDRAYMEKNQIDVNE - UNI31

500 - ISCHLGKMYSEMIFVNGFVHCDPHPGNVLVRKRPDTGKAEIVLLDHGLYQ VLTEEFRLDYCHLWQSLIWTDMDGLKQYSQRLGAADLYPLFAC

MLTARSWDSVKQGIGQAPVSATE DSEIRNNAACYLPEISQLLNHVPRQMLLILKTNDLLRSIETTLGTRSSASSFLNMSRCCIRALAE EHKKRDAGSF

FRRTQISFSEAFSLWQINLHELLLRVRALRLACWVSALLGWLTRAPHRM

For any suggestions or comments, please send an email to unitrap@crg.es