Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021065 (Fut8)
Chromosomal location
Chr 12: 78340052 - 78577325 (+)
Description
fucosyltransferase 8 Gene [Source:MGI Symbol;Acc:MGI:1858901]
RefSeq_dna
NM_016893 
RefSeq_peptide
NP_058589.2 
UniGene
Mm.400259 
MGI
MGI:1858901 
Uniprot/SWISSPROT
Q9WTS2 
Uniprot/SPTREMBL
B2X2D7 B2X2D8 Q3UYN7 Q543F5 
Human Ortholog
ENSG00000033170 (FUT8)
Omim not available
UniTrap UNI16152
Vector Insertion
Chr 12: 78340241 - 78378347
Public Clones not available
Private Clones OST466009 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26323
Vector Insertion
Chr 12: 78378443 - 78424831
Public Clones not available
Private Clones OST125138 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32928
Vector Insertion
Chr 12: 78494825 - 78513698
Public Clones IST10092B8 (tigm) IST13951A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10237
Vector Insertion
Chr 12: 78513937 - 78549459
Public Clones GST093 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000062804
Sequence
AGTCAGTGGCGCCGAAGGCTCCGTTAAGCGGCGGCCGCGGTTCCTGTTTCCGTTTCTTCCTCTCCCTTCAGTCGGGAGTAGCATCCTCCACCCCAGCACC

CCTCCCACTCTCCCGCCGCGGCCAGCTGCAGCTGGAGGCAGCGGCGGCGGCGACGGGGGACGGCGCCGACCGCCTCGCTCCCGCCTCGG - UNI16152

 - GTTGCTGTTCTGGCTGAGGCCATCTATGGCCCTGGTAGTGTTTTCATTCAAGACAAAGTCCATTCCATCTTTATTTATTAGCTGAGCAAATTCAG -

 UNI26323 - CTAATAATTTTCAAGACCCAGATTCAAGCAATAAAACATTTCTCTGCAATACCATGTGGTTTTCTTCAACATCATAATTCTATGGGGA

GGAAG CATGTAGGATCCATGAAGCACAGGACATTCAAGCCTCCCGCCCGCGTCACCAGGAAGATCTCTTTGTAAGAATAACCACAGGATTGATTTCCAG

AGAGATTAGCCTGTCTGAAGCATTATGTGTTGAAGCAAAAGAAACCTATTTTCTTGTGTGGCTAACTAGAACCAGAGTACAATGTTTCCAGTTCTTTGAG

CTCCAGGAAGATAGAGGACAGAGTTGAAACTCTGAAAATGCGGGCATGGACTGGTTCCTGGCGTTGGATTATGCTCATTCTTTTTGCCTGGGGGACCTTG

TTATTTTATATAGGTGGTCATTTGGTTCGAGATAATGACCACCCTGATCACTCCAGCAGAGAACTCTCCAAGATTCTTGCAAAGCTTGAACGCTTAAAAC

AGCAAAATGAAGACTTGAGGCGAATGGCTGAGTCTCTCCG AATACCAGAAGGCCCCATTGACCAGGGGACAGCTACAGGAAGAGTCCGTGTTTTAGAAG

AACAGCTTGTTAAGGCCAAAGAACAGATTGAAAATTACAAGAAACAAGCTAGAAATG GTCTGGGGAAGGATCATGAAATCTTAAGAAGGAGGATTGAAA

ATGGAGCTAAAGAGCTCTGGTTTTTTCTACAAAGCGAACTGAAGAAATTAAAGCATTTAGAAGGAAATGAACTCCAAAGACATGCAGATGAAATTCTTTT

GGATTTAGGACACCATGAAAG GTCTATCATGACAGATCTATACTACCTCAGTCAAACAGATGGAGCAGGGGATTGGCGTGAAAAAGAGGCCAAAGATCT

GACAGAGCTGGTCCAGCGGAGAATAACATATCTCCAG - UNI32928 - AATCCTAAGGACTGCAGCAAAGCCAGGAAGCTGGTGTGTAACATCAATA

AAGGCTGTGGCTATGGTTGTCAACTCCATCACGTGGTCTACTGTTTCATGATTGCTTATGGCACCCAGCGAACACTCATCTTGGAATCTCAGAATTGGCG

CTATGCTACTGGTGGATGGGAGACTGTGTTTAGACCTGTAAGTGAGACATGTACAGACAGATCTGGCCTCTCCACTGGACACTGGTCAG - UNI10237

 - GTGAAGTAAATGACAAAAACATTCAAGTGGTCGAGCTCCCCATTGTAGACAGCCTCCATCCTCGGCCTCCTTACTTACCACTGGCTGTTCCAGAAGA

CCTTGCAGACCGACTCCTAAGAGTCCATGGTGACCCTGCAGTGTGGTGGGTGTCCCAGTTTGTCAAATACTTGATTCGTCCACAACCTTGGCTGGAAAAG

GAAATAGAAGAAGCCACCAAGAAGCTTGGCTTCAAACATCCAGTTATTGG AGTCCATGTCAGACGCACAGACAAAGTGGGAACAGAAGCAGCCTTCCAC

CCCATCGAGGAGTACATGGTACACGTTGAAGAACATTTTCAGCTTCTCGCACGCAGAATGCAAGTGGATAAAAAAAGAGTATATCTGGCTACTGATGATC

CTACTTTGTTAAAGGAGGCAAAGACAAA GTACTCCAATTATGAATTTATTAGTGATAACTCTATTTCTTGGTCAGCTGGACTACACAATCGGTACACAG

AAAATTCACTTCGGGGTGTGATCCTGGATATACACTTTCTCTCACAGGCTGACTTTCTAGTGTGTACTTTTTCATCCCAG GTCTGTCGGGTTGCTTATG

AAATCATGCAAACCCTGCATCCTGATGCCTCTGCGAACTTCCATTCTTTGGATGACATCTACTATTTTGGAGGCCAAAATGCCCACAATCAGATTGCTGT

TTATCCTCACAAACCTCGAACTGAAGAGGAAATTCCAATGGAACCTGGAGATATCATTGGTGTGGCTGGAAACCATTGGGATGGTTATTCTAAAGGTATC

AACAGAAAACTTGGAAAAACAGGCTTATATCCCTCCTACAAAGTCCGAGAGAAGATAGAAACAGTCAAGTATCCCACATATCCTGAAGCTGAAAAATAGA

GATGAAGTAGAAGAGATTAACAACAGAACTCACTTCAGACCATCTCGGCCAAGCAGAAGACGCAGACTAACACGTGGTTCATTGATAGACACGCTCCACA

CCAAGAGCAAGCGGGAACCCTCAGATGCTGCACTGGTGGAACGCCTCTTTATGAAGGGCTGTGGTGCCCTCAAGCCCATACACAGTACAATAATGTACTC

ACACATAACACGCAAAGGGATTATTTTCTACTTTGCCCCTTTAAATATTATGTCCCCATTGAACAAACACTGCCACATTGTGTAATTTAAGTGACACAGA

CATTTTGTGTGAGACTTAAAACATGGTGCCTATATCTGAGAGACCTCTGTGACTTACCGAGAAGATGTGAACAGCTCCCTTCTCTGGGGAAGCTGGTGGT

GGTGTGGCCACTGAATTCACTCCAGTCAACAGATTCAAAATGAGAATGGATGTTTTTCCTTTATATGGTTGTCTGGATTTTTTTTTAAGTAATTTCATCA

GTTCAGTTTATCCACCTCATCATTAATAAATGAAGGATGCATCAATAAAATAAAATGAAATATTCACTCTCCATTAGGAAGTTTTGTAAAACAATGCCAT

GAACAAATTCTTTAGTACTCAATGTTTCTGGACATTCTCTTTGATAACAAAAAAATAAATTTCAAAAAGGAATTTTGTGAAGTTTCTGGAATTTTGTATC

ACTAGATTATATAGTTACAAGCTTTACAGTAGAAATATGGTAAAAATGGGCTTATAGTTTTTAAAATTTGTTTTCTACTTTTATTCTACTTTTTTCAGCT

TCTGATAGAGTAATCATATTTTAACTAAGAGAAGAATCGGTCCCTCTAATACTAGTAACTGGCTTCAGCTGGTGCATATTTTGAAGTTGCTAAGAACATG

CTTTGGTGGTGTTTATTATCTTACTTTGTATATTGTTGCTTTGTTTTAATTGAATGAAGTAGTTATTTTCTTGCTTCCAGAGAAACTAGTGCTTGCTCTT

GTCTATAAAGCTAACCAGAGC
Translation
 - UNI16152 -  - UNI26323 -  MRAWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDLRRMAESLR RI

PEGPIDQGTATGRVRVLEEQLVKAKEQIENYKKQARNG GLGKDHEILRRRIENGAKELWFFLQSELKKLKHLEGNELQRHADEILLDLGHHER RSIMT

DLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQ - UNI32928 - NPKDCSKARKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYA

TGGWETVFRPVSETCTDRSGLSTGHWSG - UNI10237 - GEVNDKNIQVVELPIVDSLHPRPPYLPLAVPEDLADRLLRVHGDPAVWWVSQFVKYLI

RPQPWLEKEIEEATKKLGFKHPVIG GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPTLLKEAKTK KYSNYEFISDNSI

SWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQ VCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAVYPHKPRTEEEIPMEPGDIIGV

AGNHWDGYSKGINRKLGKTGLYPSYKVREKIETVKYPTYPEAEK

For any suggestions or comments, please send an email to unitrap@crg.es