Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021149 (Gtpbp4)
Chromosomal location
Chr 13: 8971317 - 8995263 (-)
Description
GTP binding protein 4 Gene [Source:MGI Symbol;Acc:MGI:1916487]
RefSeq_dna
NM_027000 
RefSeq_peptide
NP_081276.2 
UniGene
Mm.41800 
MGI
MGI:1916487 
Uniprot/SWISSPROT
Q99ME9 
Uniprot/SPTREMBL
Q3TPJ4 Q3UR29 Q8CCQ5 
Human Ortholog
ENSG00000107937 (GTPBP4)
Omim not available
UniTrap UNI3556
Vector Insertion
Chr 13: 8992062 - 8995194
Public Clones BA0470 (sanger) D019A08 (ggtc) PST20210-NR (escells)
Private Clones OST369593 (lexicon) OST194719 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7312
Vector Insertion
Chr 13: 8991282 - 8991890
Public Clones RRT551 (baygenomics) RRT047 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2525
Vector Insertion
Chr 13: 8986561 - 8987001
Public Clones XS0860 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36224
Vector Insertion
Chr 13: 8984883 - 8986561
Public Clones IST14276E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3727
Vector Insertion
Chr 13: 8979226 - 8984454
Public Clones XS0981 (sanger) AE0475 (sanger) IST13405E4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33158
Vector Insertion
Chr 13: 8977773 - 8978727
Public Clones IST12093G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21066
Vector Insertion
Chr 13: 8972521 - 8973409
Public Clones not available
Private Clones OST342639 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021574
Sequence
CTCGTGCGTTCCACCGCCGGCATGGCGCATTACAACTTCAAGAAGATTACGGTGGTGCCGTCTGCCAAG - UNI3556 - GACTTTATTGACCTAACA

TTATCCAAGACTCAACGAAAGACTCCAACGGTTATTCATAAACATTATCAAATTCATCGGATTCGACATTTTTATATGAGAAAAGTCAAATTTACTCAAC

AGAATTACCATGACAGACTGTCACAGATTCTGTCGGATTTCCCCAAATTGGAT - UNI7312 - GATATCCATCCGTTTTATGCTGACTTGATGAATA

TTCTCTATGACAAGGATCACTACAAGTTGGCTCTAGGTCAAATAAATATTGCCAAAAACTTGGTGGACAA TGTTGCTAAAGATTATGTGCGTCTTATGA

AATATGGTGATTCTCTGTACCGATGCAAGCAGCTGAAGCGCGCGGCCCTTGGACGAATGTGTACTATTATCAAGAGACAGAGGCAGAGCTTGGAGTATCT

GGAACAAG TACGTCAACATTTATCCCGCTTGCCAACCATTGATCCAAATACAAGGACTCTGCTTTTGTGTGGGTATCCAAATGTTGGGAAATCCAGCTT

CATCAACAAG GTGACAAGAGCAGATGTGGACGTTCAACCCTATGCATTTACCACCAAATCTCTGTTTGTTGGGCACATGGATTATAAGTATCTGCGCTG

GCAG GTTGTAGATACCCCAGGGATTTTGGATCATCCTTTGGAGGATCGGAACACCATTGAGATGCAGGCCATCACAGCCCTGGCCCACCTCCGAGCTGC

AGTTCTGTATGTGATGGATCTGTCTGAGCAGTGTGGACATGGGTTAAAGGAGCAGTTAGAACTCTTCCAGAATATCAGACCTCTGTTTATCAACAAG - 

UNI2525 - CCTCTTATTGTTGTAGCAAACAAATGTGATGTGAAGAGAATAGCTGAACTTTCTGAAGAAGATCAG AAAATATTTCTAGACTTGCAGGC

TGAAGGATTCCCTGTCATCGAGACCAGTACCCTGACTGAGGAAGGTGTCATTCAAGTTAAAACAGAG GCGTGTGACAGGCTTTTGGCTCACCGAGTAGA

AACGAAAATGAAAGGAAATAAAGTGAATGAGGTTCTGAACAGATTGCATTTAGCTGTGCCCAACAAGAGAGATGATAAG - UNI3727 - GAGAGACC

CCCTTTCATCCCAGAAGGAGTGATAGCTCGAAGGAAGAGAATGGAGATTGAAGAGCCCAAGAAGAAGAGG - UNI33157 - GAGCGAGATCTTGAGC

TGGAAATGGGAGATGATTACATTTTGGATCTTCAGA - UNI33157 - AATACTGGGACTTAATGAATTCATCTGAGAAATATGATAAGATACCAGAA

ATTTGGGAAGGCCACAATGTTGCTGATTATATTGATCCTGCTATCATGAAG - UNI33157 - AAATTAGAAGAGTTGGAAAAGGAAGAAGAGCTAAG

AACAGCTGCTGGGGAGTATGACAGTGACTCTGAGAGTGAAGACGAGGAAATGATGGAAATCCGACAGCTGGCAAAGCAAATTAGAGAAAAGAAGAAGTTG

AAAATTCTACAGTCCAAAGAAAAGAATAAACAGGGACCCAGGATGCCCCGAACTGCCAAGAAG GTTCAACGGGCAGATTTAGAGAATGAGATGCGTAGT

CTTGGTGTGGACATGGATGATAAAAACAAT GCCCACTATGCAGTCCAGGCAAGAAGGTCTCGGAGTGTCACGAGGAAAAGAAAACGAGAAGAATCTGTT

CCACCCTCTTCCACAGCGCGGAGTCGCAGTTGTTCTAGAACTCCACGTGATGTTTCTGGTCTTCGGGATGTCAAG - UNI21066 - ATGGTGAAGAA

AGCCAAGACTATGATGAAGAAAGCTCAGAAGAAGATGAATCGCTTGGGGAAGAAAGGGGAAGCTGATAGGCATGTGTTTGATATGAAGCCCAAGCACTTG

CTGTCTGGGAAGAGGAAAGCTGGTAAAAAGGACAGGAGATAATGTCCTCTTCAGTTGGAACAGTTTAAGTAGACTCTTGGTTATTTTGGGTGTGGTATGG

TGTGTTATAGAATTTGGAATCACCATCTGTTGACCAAAAGAAACAGTGGGAATGACTTTTAAATGCTTGCTGCTTTGCTGGAAACTGGCAAACCCTACTA

AGTGTGCAGTGCTGTGCTCACTGCGCAGTTTGGGTTTTTATGTCCAGTGCGTTCCGTACTTGATGAGCTTCTTTCAGCATTTTACAGAAAAGACTTATTG

GTGTACGGAGGCTGCGTGGGTGGAGGAAAACTGTTTTGTAGTGGGACTTTTGTCACCTAAAGTACCTATTTTTGTTAAGAAAGTATACCTGCTGGGAGGT

CTAGGCAGAAGGCTATCCTCCTTACATTTAGGGTTTATCAGAGCTTAAACTACTCTTAAATTATTTTCTAAACCTGTAGTACAATGTATCATTGTAACTT

CAACCATTTTATCCAAAGTAAACACCCAGCAAAAACATAGTTTGATGACTTACATTTTGTTTGATTTAATTGCAATACACTTGATGACCAAAAGGGGTGG

TGGTGGCAGGGAATAGGACTTTGCTTTTTTGTTCTTAGAATAAAAAATAAAGGAAGTAAGTGCCTGGGGTATAGGCTCAAAACCAAAAAAAAAAAAAAAA

GAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAATGTCTTCTTTCATAAACACTTGCTGAATTAAGATTGATGTCCTGGAAA

GTACAAAAACATCTACAAGCGGGATCCCGGTGTACCTGGAAGTGCAGCCCTGTCCTCAGATTAGAGGATAATCTTCAGACAGTCAGTGCTTCCTGTTAGG

CTGCAGCTTCTGGCCTTTATGAGAATCCAGCGACTACCGACGGATTACGTACTCTAGCCTAAGATTCTTTGGACTCTATTGAGACCTCTTTTTTAAATTG

GCTTTCTAATGTGTTTTAGTTCTCTGAAGAAGTTTGATGTCTTGATCTTTTTTTTTTTTAATGTCTAGATGATTAAAGTCTATAATCATTTCT
Translation
MAHYNFKKITVVPSAK - UNI3556 - DFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILSDFPKLD - UNI7312 - D

IHPFYADLMNILYDKDHYKLALGQINIAKNLVDN NVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQRQSLEYLEQV VRQHLSRLPTIDPNTRT

LLLCGYPNVGKSSFINK VTRADVDVQPYAFTTKSLFVGHMDYKYLRWQ VVDTPGILDHPLEDRNTIEMQAITALAHLRAAVLYVMDLSEQCGHGLKEQ

LELFQNIRPLFINK - UNI2525 - PLIVVANKCDVKRIAELSEEDQ KIFLDLQAEGFPVIETSTLTEEGVIQVKTE ACDRLLAHRVETKMKGNKV

NEVLNRLHLAVPNKRDDK - UNI3727 - ERPPFIPEGVIARRKRMEIEEPKKKR - UNI33157 - ERDLELEMGDDYILDLQK - UNI33157

 - KYWDLMNSSEKYDKIPEIWEGHNVADYIDPAIMK - UNI33157 - KLEELEKEEELRTAAGEYDSDSESEDEEMMEIRQLAKQIREKKKLKILQ

SKEKNKQGPRMPRTAKK VQRADLENEMRSLGVDMDDKNN AHYAVQARRSRSVTRKRKREESVPPSSTARSRSCSRTPRDVSGLRDVK - UNI21066

 - MVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR

For any suggestions or comments, please send an email to unitrap@crg.es