Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021210 (Akr1c6)
Chromosomal location
Chr 13: 4433607 - 4456649 (+)
Description
aldo-keto reductase family 1, member C6 Gene [Source:MGI (curated);Acc:Akr1c6-001]
RefSeq_dna
NM_030611 
RefSeq_peptide
NP_085114.1 
UniGene
Mm.196666 
MGI
MGI:1933427 
Uniprot/SWISSPROT
P70694 
Uniprot/SPTREMBL
Q3UEM0 
Human Ortholog
not available
Omim not available
UniTrap UNI32091
Vector Insertion
Chr 13: 4448725 - 4453709
Public Clones IST13533C5 (tigm) IST13191F11 (tigm) IST11512A4 (tigm) IST12482F10 (tigm)
IST11430B3 (tigm) IST10886H6 (tigm) IST11430D8 (tigm) IST14601E9 (tigm)
IST14869D1 (tigm) IST14522F10 (tigm) IST14666C8 (tigm) IST13719B10 (tigm)
IST11640B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021630
Sequence
GTATCTTCTCAGTTGGTGGGCTGAGAAGCCATGGATTCTAAGCAGCAGACAGTGCGTCTAAGTGATGGTCACTTCATCCCTATACTGGGGTTTGGTACCT

ATGCACCTCAAGAG GTACCTAAGAGTAAGGCTACAGAAGCTACTAAAATAGCCATAGATGCTGGTTTCCGCCATATTGATTCTGCTTCTATGTATCAAA

ATGAAAAGGAAGTAGGACTAGCCATCCGAAGCAAGATAGCAGATGGCACTGTGAAGAGGGAAGATATATTTTACACATCAAAG GTTTGGTGTACTTTTC

ATCGTCCAGAACTCGTACGGGTCTGCTTGGAACAGTCATTGAAGCAACTCCAGTTGGACTATGTGGACCTGTACCTCATTCATTTCCCAATGGCCATGAA

G CCGGGAGAAAATTATCTCCCAAAAGATGAAAATGGAAAATTAATATATGATGCTGTGGATATCTGTGACACCTGGGAA GCCATGGAGAAATGCAAGG

ATGCAGGATTGGCCAAGTCCATTGGGGTGTCCAACTTTAACCGCAGGCAGCTGGAGAAGATCCTGAAAAAGCCGGGGCTCAAGTACAAGCCTGTGTGCAA

CCAG GTAGAATGTCATCCTTATCTCAATCAGGGAAAACTTCTGGATTTCTGCAGGTCAAAAGACATTGTTCTGGTTGCTTACAGTGCTCTGGGAAGCCA

TCGTGAAAAACAATG GGTTGATCAGAGCTCTCCTGTTCTTTTGGATAATCCAGTTCTTGGCTCAATGGCAAAAAAGTACAATCGAACTCCTGCGCTGAT

TGCCCTTCGCTACCAGCTACAACGTGGGGTTGTGGTCCTCGCCAAGAGTTTCTCTGAGAAGAGGATAAAAGAGAATATGCAG - UNI32091 - GTTT

TTGAATTTCAGTTGACTTCAGAGGACATGAAAGTCCTCGATGACCTGAATAAAAATATCCGATACATAAGTGGTTCTAG CTTTAAGGACCATCCTGATT

TTCCATTTTGGGATGAATACTAACTGGAGGTCCATTTTGTGCCTTGTGCCAGATGTCACTGCATTGGAAGAGTGTATAGGAAGAGTATTCTCAAAATGTG

ATGATTACATATCACCCTAATCCAAGCTTCTGAGCAATTCTGGCTCTGCTGAATCTACCATTTTAACCAAGAAAGCCAAAACTATGTATATTTCTCCTTT

CTAAGAAATAAAAGAATCGTTATTCTTTAGCATTT
Translation
MDSKQQTVRLSDGHFIPILGFGTYAPQE VPKSKATEATKIAIDAGFRHIDSASMYQNEKEVGLAIRSKIADGTVKREDIFYTSK VWCTFHRPELVRVC

LEQSLKQLQLDYVDLYLIHFPMAMK PGENYLPKDENGKLIYDAVDICDTWE AMEKCKDAGLAKSIGVSNFNRRQLEKILKKPGLKYKPVCNQ VECHP

YLNQGKLLDFCRSKDIVLVAYSALGSHREKQW WVDQSSPVLLDNPVLGSMAKKYNRTPALIALRYQLQRGVVVLAKSFSEKRIKENMQ - UNI32091

 - VFEFQLTSEDMKVLDDLNKNIRYISGSS SFKDHPDFPFWDEY

For any suggestions or comments, please send an email to unitrap@crg.es