Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021218 (Gdi2)
Chromosomal location
Chr 13: 3537395 - 3565066 (+)
Description
guanosine diphosphate (GDP) dissociation inhibitor 2 Gene [Source:MGI Symbol;Acc:MGI:99845]
RefSeq_dna
NM_008112 
RefSeq_peptide
NP_032138.3 
UniGene
Mm.469624 Mm.476344 Mm.153226 
MGI
MGI:99845 
Uniprot/SWISSPROT
Q61598 
Uniprot/SPTREMBL
Q3TIY6 Q3UC72 Q3UPA3 Q3UUX9 Q5RKT4 Q9CZ18 
Human Ortholog
ENSG00000057608 (GDI2)
Omim not available
UniTrap UNI20205
Vector Insertion
Chr 13: 3537590 - 3548108
Public Clones (sanger) IST13879H11 (tigm) IST10977E3 (tigm)
Private Clones OST369571 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14674
Vector Insertion
Chr 13: 3550335 - 3553657
Public Clones (sanger) FHCRC-GT-S1-11F1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11340
Vector Insertion
Chr 13: 3553793 - 3555559
Public Clones A054C07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110714
Sequence
TGGCGGCCGGCCTCTCCTCCTCCTCAGCTCCGTTTTTCCTCTCCTCGCTTTTTCCCTTTCCCCCCGACCCCCGGGGCCCAGAGCGGCCGGACTTCTCGCT

CCCTTCTCTACGGCGGCCTCCGAGCCCCCGCGTGCGCTCCTTTCCCCGCCATGAATGAGGAATACGACGTGATCGTGCTGGGCACCGGCCTGACG - UN

I20205 - TTATACAAAAGGTTTAAATTACCAGGACAACCGCCAGCATCAATGGGAAGAGGAAGAGACTGGAATGTTGACTTAATTCCCAAGTTCCTTA

TGGCCAATG - UNI14674 - GTCAGTTGGTGAAGATGCTGCTTTTCACAGAGGTCACTCGTTACATGGACTTCAAAGTGATTGAGGGAAGCTTTGTC

TACAAGGGAGGGAAAATCTACAAGGTTCCTTCCACTGAAGCAGAAGCCCTGGCATCTA - UNI11340 - GCTTAATGGGACTGTTTGAGAAACGCCG

TTTCAGGAAGTTCCTGGTTTATGTTGCCAACTTTGATGAAAAAGATCCTAGAACTTTCGAGGGTGTTGATCCTAAGAAGACCTCCATGAGAGATGTGTAT

AAGAAGTTTGATTTGGGCCAAGATGTTATAGACTTTACTGGCCATTCTCTTGCACTGTACAGAACAGATGA CTACTTAGATCAGCCGTGTTGTGAAACC

ATTAATAGAATTAAACTTTACAGCGAGTCTTTGGCAAGATACGGTAAAAGCCCGTACCTGTATCCGCTTTATGGTCTTGGAGAATTGCCGCAAGGATTTG

CAAG GTTAAGTGCCATATATGGAGGTACCTACATGTTGAATAAACCAATTGAAGAAATCATTGTGCAAAATGGAAAAGTGGTTGGTGTAAAATCCGAAG

GAGAG ATTGCTCGCTGTAAACAGCTCATCTGTGATCCCAGCTATGTAAAAGATCGGGTTGAAAAAGTGGGCCAGGTAATCAGAGTGATCTGTATCCTTA

GCCACCCTATCAAGAACACCAACGATGCCAACTCCTGCCAGATCATCATTCCACAGAACCAAGTCAACCGCAAGTCAG ATATCTATGTTTGCATGATCT

CCTTTGCACATAATGTGGCAGCACAGGGCAAGTATATTGCCATTGTAAGTACAACCGTGGAGACCAAGGAACCAGAGAAAGAAATCAGACCGGCTTTGGA

GCTCTTGGAACCAATTGAACAGAA ATTTGTCAGCATCAGTGACCTCTTTGTACCTAAAGATTTGGGAACAGATAGTCAG ATCTTCATTTCCCGTGCCT

ATGATGCTACCACGCACTTTGAGACAACCTGTGATGACATTAAAGATATCTACAAGAGGATGACAGGATCTGAGTTTGACTTTGAGGAAATGAAGCGCAA

GAAGAATGACATTTATGGAGAAGACTAACAGCAGTACATATTATGTAATAATTAGGACAAACTTAAAATTTGGCAAATAATGTATATTGTATGAAATCAA

TACTGTAAGCCCTGCTTTTATGATCAAAATGGAGATTGAAGAGTGCTATACCAGTGAATGCTCCTTCACTTTCTAATATCATGTATTAACTTGTTTTCAT

GGAATGGCTAGTCAGAATTGGTTGGTTCTGTTCAGTTTAACCAGACTGCATTTTGTTCTAAAACAAATATTGATATCGATAGAGAACTTGTATCATTTAA

TCAGTGTAGCCTTTGCGATTGTGTGATCCAAGAGCTGGATCCATACAATTTGTGCCACCCTGAAATTGGGACTCTAAATTGAGTATCCTTTGGTTTCTGA

AGACGTTCAACGTTTTCTCTATTTTGTTATGTCAAGTATCACAGCAGGGCCAATAGAAGAGAGCCACATGTTTTGTTTATGAGGGTAGCCAAACTTCAGA

CCTACAACAGTTGCTGAGAAAAGGAAAGGAGCCTTAAGGTAAAGCAGGTAAAATACAGGAGCCCCTTTTATCCCAGACACGGCTCCTCCCCCGGACCAAG

CTGCAATGCAGTATTAATCTGACAGAGCCTCAATGTCAACGATGCCTGTTCCAAAATGGCTCCAGATGATTTCTGTACTGCAAAATAAAGCCAAACTCTG

GAAACC
Translation
MNEEYDVIVLGTGLT - UNI20205 - LYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANG - UNI14674 - GQLVKMLLFTEVTRYMDFKVIEG

SFVYKGGKIYKVPSTEAEALASS - UNI11340 - SLMGLFEKRRFRKFLVYVANFDEKDPRTFEGVDPKKTSMRDVYKKFDLGQDVIDFTGHSLALY

RTDD DYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR RLSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGE IARCKQLICDPSYV

KDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSD DIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQK KFVSI

SDLFVPKDLGTDSQ IFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED
Transcript ENSMUST00000059515
Sequence
TGGCGGCCGGCCTCTCCTCCTCCTCAGCTCCGTTTTTCCTCTCCTCGCTTTTTCCCTTTCCCCCCGACCCCCGGGGCCCAGAGCGGCCGGACTTCTCGCT

CCCTTCTCTACGGCGGCCTCCGAGCCCCCGCGTGCGCTCCTTTCCCCGCCATGAATGAGGAATACGACGTGATCGTGCTGGGCACCGGCCTGACG - UN

I20205 - GAATGTATCCTGTCGGGGATAATGTCAGTGAATGGGAAGAAGGTTCTTCATATGGATCAGAACCCATACTATGGAGGAGAAAGTGCGTCTA

TAACACCGCTGGAAGAT TTATACAAAAGGTTTAAATTACCAGGACAACCGCCAGCATCAATGGGAAGAGGAAGAGACTGGAATGTTGACTTAATTCCCA

AGTTCCTTATGGCCAATG - UNI14674 - GTCAGTTGGTGAAGATGCTGCTTTTCACAGAGGTCACTCGTTACATGGACTTCAAAGTGATTGAGGGA

AGCTTTGTCTACAAGGGAGGGAAAATCTACAAGGTTCCTTCCACTGAAGCAGAAGCCCTGGCATCTA - UNI11340 - GCTTAATGGGACTGTTTGA

GAAACGCCGTTTCAGGAAGTTCCTGGTTTATGTTGCCAACTTTGATGAAAAAGATCCTAGAACTTTCGAGGGTGTTGATCCTAAGAAGACCTCCATGAGA

GATGTGTATAAGAAGTTTGATTTGGGCCAAGATGTTATAGACTTTACTGGCCATTCTCTTGCACTGTACAGAACAGATGA CTACTTAGATCAGCCGTGT

TGTGAAACCATTAATAGAATTAAACTTTACAGCGAGTCTTTGGCAAGATACGGTAAAAGCCCGTACCTGTATCCGCTTTATGGTCTTGGAGAATTGCCGC

AAGGATTTGCAAG GTTAAGTGCCATATATGGAGGTACCTACATGTTGAATAAACCAATTGAAGAAATCATTGTGCAAAATGGAAAAGTGGTTGGTGTAA

AATCCGAAGGAGAG ATTGCTCGCTGTAAACAGCTCATCTGTGATCCCAGCTATGTAAAAGATCGGGTTGAAAAAGTGGGCCAGGTAATCAGAGTGATCT

GTATCCTTAGCCACCCTATCAAGAACACCAACGATGCCAACTCCTGCCAGATCATCATTCCACAGAACCAAGTCAACCGCAAGTCAG ATATCTATGTTT

GCATGATCTCCTTTGCACATAATGTGGCAGCACAGGGCAAGTATATTGCCATTGTAAGTACAACCGTGGAGACCAAGGAACCAGAGAAAGAAATCAGACC

GGCTTTGGAGCTCTTGGAACCAATTGAACAGAA ATTTGTCAGCATCAGTGACCTCTTTGTACCTAAAGATTTGGGAACAGATAGTCAG ATCTTCATTT

CCCGTGCCTATGATGCTACCACGCACTTTGAGACAACCTGTGATGACATTAAAGATATCTACAAGAGGATGACAGGATCTGAGTTTGACTTTGAGGAAAT

GAAGCGCAAGAAGAATGACATTTATGGAGAAGACTAACAGCAGTACATATTATGTAATAATTAGGACAAACTTAAAATTTGGCAAATAATGTATATTGTA

TGAAATCAATACTGTAAGCCCTGCTTTTATGATCAAAATGGAGATTGAAGAGTGCTATACCAGTGAATGCTCCTTCACTTTCTAATATCATGTATTAACT

TGTTTTCATGGAATGGCTAGTCAGAATTGGTTGGTTCTGTTCAGTTTAACCAGACTGCATTTTGTTCTAAAACAAATATTGATATCGATAGAGAACTTGT

ATCATTTAATCAGTGTAGCCTTTGCGATTGTGTGATCCAAGAGCTGGATCCATACAATTTGTGCCACCCTGAAATTGGGACTCTAAATTGAGTATCCTTT

GGTTTCTGAAGACGTTCAACGTTTTCTCTATTTTGTTATGTCAAGTATCACAGCAGGGCCAATAGAAGAGAGCCACATGTTTTGTTTATGAGGGTAGCCA

AACTTCAGACCTACAACAGTTGCTGAGAAAAGGAAAGGAGCCTTAAGGTAAAGCAGGTAAAATACAGGAGCCCCTTTTATCCCAGACACGGCTCCTCCCC

CGGACCAAGCTGCAATGCAGTATTAATCTGACAGAGCCTCAATGTCAACGATGCCTGTTCCAAAATGGCTCCAGATGATTTCTGTACTGCAAAATAAAGC

CAAACTCTGGAAACC
Translation
MNEEYDVIVLGTGLT - UNI20205 - ECILSGIMSVNGKKVLHMDQNPYYGGESASITPLED LYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANG

 - UNI14674 - GQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASS - UNI11340 - SLMGLFEKRRFRKFLVYVANFDEKDP

RTFEGVDPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDD DYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR RLSAIYGGTYML

NKPIEEIIVQNGKVVGVKSEGE IARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSD DIYVCMISFAHNVAAQGK

YIAIVSTTVETKEPEKEIRPALELLEPIEQK KFVSISDLFVPKDLGTDSQ IFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED


For any suggestions or comments, please send an email to unitrap@crg.es