Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021338 (Lrrc16a)
Chromosomal location
Chr 13: 24104528 - 24372664 (-)
Description
leucine rich repeat containing 16A Gene [Source:MGI (curated);Acc:Lrrc16a-001]
RefSeq_dna
NM_026825 
RefSeq_peptide
NP_081101.3 
UniGene
Mm.211047 
MGI
MGI:1915982 
Uniprot/SWISSPROT
Q6EDY6 
Uniprot/SPTREMBL
Q9CTA1 A2A6Y2 
Human Ortholog
ENSG00000079691 (LRRC16)
Omim not available
UniTrap UNI4295
Vector Insertion
Chr 13: 24270127 - 24368325
Public Clones AG0574 (sanger) AF0507 (sanger) RRP113 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4536
Vector Insertion
Chr 13: 24270075 - 24270127
Public Clones AS0596 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3853
Vector Insertion
Chr 13: 24256792 - 24265484
Public Clones AP1041 (sanger) AX0105 (sanger) AS0602 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28722
Vector Insertion
Chr 13: 24117805 - 24128053
Public Clones not available
Private Clones OST22604 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29258
Vector Insertion
Chr 13: 24116191 - 24116405
Public Clones not available
Private Clones OST1708 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34726
Vector Insertion
Chr 13: 24104529 - 24111580
Public Clones IST13417D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110396
Sequence
AGTAACTGGTGGCACCCAGTGAAG CACATGTACAATTTTTTGGCCCAGCCCAACACCATTGTTCATCTGGATCTATCTAATACAGAATGTTCTCTGGAG

ATG GTGTGTAGCGCTCTCCTCCGGGGTTGCCTTCAGTGTCTCGCTGTGCTCAATCTCTCCAGATCTGTCTTCTCTCACAG GAAAGGAAAGGAAGTCCC

TCCGTCTTTCAAGCAGTTTTTCAGCAGTTCTCTGGCTTTGATCCAAATCAACCTTTCAGGCACGAAGCTGTCTCCCGAGCCCTTGAA AGCGCTGCTCTT

GGGCCTGGCCTGCAATCATAGCCTGAAGGGAGTCTCTCTGGATCTCAGCAACTGTGAG CTGAGGTCAGGAGGAGCTCAAGTGTTAGAAGGCTGCATCGC

Translation
SNWWHPVK HMYNFLAQPNTIVHLDLSNTECSLEM VCSALLRGCLQCLAVLNLSRSVFSHR RKGKEVPPSFKQ  
Transcript ENSMUST00000110398
Sequence
TTTTTTTTTTTTTTTTTTTTTTTGGTACTGCGGGCGCGCGGCAACCTTGGATCAACGCCCCGCTGCTCCGGCCGGCCCACTCTTTCCTTGCAAGCTGCGG

CTTCCTCGCGGAAACATTAAAGGGTCTGAAGAAGGGCGCGGGGCCGAGAGTCAGAGAGTGGGACCCGGGATCTCCCCGCGCCCAGTGGGGCAACCATGAC

CGACGAGAGCTCCGATGTCCCCCGGGAGTTAATGG AAAGCATCAAGGATGTTATTGGCAGGAAGATCAAAATCTCAGTGAAGAAGAAAGTGAAGTTGGA

AGTGAAGGGCGACAGGGTGGAAAACAAAGTGCTG - UNI4295 - - UNI4536 - GTGCTCACATCATGCCGAGCCTTCCTCCTGTCAGCACGCAT

CCCCAGCAAG - UNI4536 - CTCGAGTTAACCTTCAGTTATCTAGAGATTCATGGAGTCATCTGCCACAAGCCAGCCCAG - UNI3853 - ATGG

TTGTGGAGACTGAGAAGTGTAACATGTCCATGAAGATGGTGTCCCCAGAGGATGTGAGTGAAGTGCTGGCTCACATAGGCACCTGCTTGCGGAGGATATT

CCCAGGCCTTTCCCCACT GAGAATCATGAAGAAAGTCTCCATGGAGCCATCTGAACGTCTGGCCAGTCTCCAGGCCCTGTGGGACAGCCAGACCTTGGC

TGAGCCAGGCCCCTGTG GTGGGTTTTCTCAGATGTATGCCTGTGTGTGCGACTGGCTGGGCTTTTCATACAAGGAAGAAGTGCAGTGG GATGTGGATA

CAATTTATCTGACACAAGACACCAGGGAATTAAATTTACAGGACTTCAGTCATCTCGAGCACAG AGACCTGATCCCCATCATTGCTGCCCTGGAGTATA

ACCAGTGGTTCACCAAACTGTCCTCTAAGGATCTCAAACTG TCCACGGATGTTTGTGAACAGATTTTGAGAGTGGTGAGTAGGTCCAATCGACTGGAAG

AGTTGGTGTTGGAAAATGCTGGACTCAGAAT AGATTTTGCACAGAAATTGGCCGGTGCTCTAGCACACAATCCTAACTCAGGACTTCACACAATCAACC

TTGCTGGGAACTCGCTGGAGGATCGAG GTGTGTCCTCCTTAAGTATTCAATTTGCCAAACTCCCAAAGGGATTGAAGCATTTGAACCTCTCTAAAACCT

CATTGTCACCTAAAG GGGTGAACAGCCTTTGTCAGTCCCTCAGTGCCAACCCTCTGACTGCCTCTACCCTCACCCACCTGGACCTCTCAGGGAATGCCC

TCCGCGGAGATGACCTCTCG CACATGTACAATTTTTTGGCCCAGCCCAACACCATTGTTCATCTGGATCTATCTAATACAGAATGTTCTCTGGAGATG 

GTGTGTAGCGCTCTCCTCCGGGGTTGCCTTCAGTGTCTCGCTGTGCTCAATCTCTCCAGATCTGTCTTCTCTCACAG GAAAGGAAAGGAAGTCCCTCCG

TCTTTCAAGCAGTTTTTCAGCAGTTCTCTGGCTTTGATCCAAATCAACCTTTCAGGCACGAAGCTGTCTCCCGAGCCCTTGAA AGCGCTGCTCTTGGGC

CTGGCCTGCAATCATAGCCTGAAGGGAGTCTCTCTGGATCTCAGCAACTGTGAG CTGAGGTCAGGAGGAGCTCAAGTGTTAGAAGGCTGCATCGCTGAA

ATCCACAACATCACCAGCTTAGATATCTCTGACAATG GTTTAGAATCCGACCTATCTACCCTAATTGTGTGGCTCAGTAAAAACAGATCAATACAGCAC

CTGGCATTGGGCAAAAATTTTAATAATATGAAATCCAA AAATCTGACGCCTGTGTTGGACAACTTAGTGCAGATGATCCAAGATGAAGACTCT CCTCT

GCAGTCGTTGTCCCTGGCTGACTCAAAACTCAAGGCTGAGGTCACCATCATCATCAATGCCCTGGGCAGCAACACCTCCCTGACCAAAGTGGACATCAGT

GGGAATGGCATGGGGGACATGGGAGCGAAGATGCTGGCCAAGGCTCTCCAGATCAACACCAAACTCAG GACAGTCATCTGGGACAAAAACAACATCACT

GCACAAGGCTTTCAAGACATAGCTGTTGCTATGGAAAA GAACTACACACTGCGATTTATGCCAATTCCGATGTATGATGCCGCTCAAGCTCTCAAAACC

AACCCCGAGAAAACAGAAGAGGCTCTGCAGAAG ATAGAAAATTATCTGCTCCGGAATCACGAGACCAGGAAATACCTTCAGGAGCAGGCCTATCGCCTC

CAGCAGGGCATCGTCACCAGCACCACCCAGCAG ATGATTGACCGGATATGTGTGAAGGTTCAGGATCACCTCAACTCCTTACGAGCCTGTGGGGGTGAT

GCTATTCAGGAGGATTTAAAGGCAGCGGAGCGGCTCATGCGAGATGCTAAGAACTCTAAAACA TTGTTGCCCAATTTATATCATGTGGGCGGTGCATCC

TGGGCAGGAGCCAGTGGGCTGTCATCCAGTCCCATTCAGGAGACCCTGGAGTCGATGGCTGGAGAAGTCACAAGAGTGGTGGATGAACAACTGAAG GAT

TTGCTAGAATCCATGGTGGACGCAGCCGAGACCCTCTGCCCCAACGTCATGAGAAAAGCCCACATCCGACAGGACCTGATCCATGCCAGCACCGAAAAGA

TTTCCATCCCACGTACCTTTGTTAAAAATGTCCTGTTGGAACAGTCCGGGATTGACATTCTTAACAAAATCAG TGAGGTGAAGCTGACAGTGGCCTCGT

TCTTGTCTGACCGGATCGTCGATGAGATCCTGGATTCTCTCTCCAGCAGCCATCGGAAGCTG GCCAACCATTTCAGCAGGCTAAACAAGAGCCTTCCCC

AGCGAGAGGACCTAGAGGTGGAGCTGGTGGAGGAGAAGCCGGTGAAACGGGCCATCCTCACGGTAGAGGATCTCACAGAGGTGGAGAGGCTGGAAGACCT

AGACACTTGTATG ATGACTCCTAAGTCCAAGAGGAAGAGCATCCACAGCCGAATGCTGCGGCCTGTCTCCAGGGCCTTCG AAATGGAGTTTGATCTTG

ATAAAGCCCTGGAAGAGGTGCCGATTCACATCGAAGACCCACCTTTCCCATCAGTCCGGCAAGAGAAGCGAAGCTCGGGGTTAATCTCTGAGCTGCCCTC

GGAGGAAGGCAGGAGACTGGAACACTTCACCAAGTTAAGGCCCAAGCGGAACAAGAAGCAGCAACCTACGCAAGCAGCG GTCTGTACCATCAGCATCTT

GCCCCAGGATGGAGAACAGAATGGCCTCATGGGCAGAGTGGATGAAGGGGTAGATGAGTTTTTCACCAAGAAGGTGACTAAAATGGATTGCAA GAGGTC

ATCCTCGCGCTCCTCAGATGCCCACGAACTCGGGGAAGGAGATGAGAAGAAAAAACGGGACTCTCGGAGGAGTGGCTTCCTCAACCTGATTAAATCCAGG

TCCAGATCTGAGCGGCCACCCACAGTCCTGATGACGGAAGAGCTCTCCTCCCCGAAAGGGGCAATGCGGAGCCCACCAGTGGATACCACCAGGAAGGAGA

TAAAGGCAGCGGAGCACAATGGTGCTCCAGACCGCACAGAAGAGATTAAGACACCGGAACCCCTGGAGGAGGGTCCAGCAGAGGAAGCTGGCAGGGCTGA

GCGCAGTGACAGCAGGGGCAGCCCGCAGGGTGGCCGGCGCTATGTGCAGGTGATGGGCAGCGGCCTGCTGGCCGAGATGAAGGCCAAGCAGGAGCGGAGG

GCAGCATGTGCACAGAAG - UNI28722 - AAGCTCGGCAATGATGTCATCTCCCAGGATCCTTCCAGCCCAGTCTCGTGCAACACAGAGCGTTTAGA

AGGAGGGGCGACAG - UNI29258 - TGCCTAAACTGCAACCAGGTCTTCCAGAGGCCCGCTTTGGTTCGGGAACACCAGAAAAGAATGCCAAAGCTG

AACCCAGAGTGGATGGAGGCTGCAGGTCCCGGAGCTCCTCCAGCATGCCCACCAGCCCAAAGCCCCTCCTTCAGTCCCCTAAGCCCAGCCCTTCAGCCCG

GCCTTCTATCCCTCAGAAGCCAAGAACTGCCTCCCGACCTG - UNI29258 - AAGACACCCCAGACTCTCCATCTGGTCCTAGTTCCCCTAAAGTTG

CCCTCCTTCCACCCATCCTCAAAAAAGTCTCCTCGGACAAGGAGCGTGACGGCCAGAACAGCTCACAGTCCAGTCCTAGGAGCTTCTCCCAGGAAG - U

NI34726 - CCTCAAGGAGAAGCTGGGGCCCGGCCCAGGAGTATCAAGAACAGAAGCAACGGTCCTCGGGCAAAGATGGTCACCAAGGGAGCAAATGCA

GTGACTCTGGAGAAGAGGCAGAAAAAGAGTTTATTTTTGTGTAATGGTGCCCACCCCAAGCCTCTCCATGCAGGGCGCTCTCCTCAGCTCTCAGAGAGGA

GCCAGGGCCAGTACCTCTTCTCTCTTCTCTTGGTGCTTTCTTCTTTCTCTCCTTTCTTCTTTCTCATTTATATATATTTTCAAATTTTTGGTCTTCCCCC

ATTCTTGGCATTTGATTTCTAAACACTGTTTCTTATGCCTTCAACAAAAAGCCAGCAATTATTCCATGGGCCCTACTTGAATTTCTCTGAGGCAGCTACA

CATTGCCCTGCATGGTGAGTTGTTTTTGGAAATTAATGAAGTAACTGGACTCACACCCAAGTAACAATCCGGGAGGTCCTGGGGTGCTACAGGGTGTGTT

TGTGTCAGATCCACACATAACTCGATAGAGCAATTTATTCTTGATGTATGCAATTGCACATTGTAATTATATTAACAGAGCACACTAATAAATAATTTGT

ATAAATTATAAATATTAGATCTTGGGCACAGTTCTTACATTCTTTTGTGGGACATTTCCTTCCCCATGTAGAATTGTACATTTAAACCTTGGTTGGTAAT

ATTTGCAGACCATCGGCAAGCACAGCTAAAAACAGTGTGAGAAGCTCAGATTCATGTATATACTTGATTGGAATGAGGTCTTATAAATATTCATGTTTCT

GAAGGCCTTT
Translation
  - UNI4295 - - UNI4536 -  - UNI4536 -  - UNI3853 -   MYACVCDWLGFSYKEEVQW DVDTIYLTQDTRELNLQDFSHLEHR 

RDLIPIIAALEYNQWFTKLSSKDLKL STDVCEQILRVVSRSNRLEELVLENAGLRI IDFAQKLAGALAHNPNSGLHTINLAGNSLEDRG GVSSLSIQ

FAKLPKGLKHLNLSKTSLSPKG GVNSLCQSLSANPLTASTLTHLDLSGNALRGDDLS HMYNFLAQPNTIVHLDLSNTECSLEM VCSALLRGCLQCLA

VLNLSRSVFSHR RKGKEVPPSFKQFFSSSLALIQINLSGTKLSPEPLK KALLLGLACNHSLKGVSLDLSNCE LRSGGAQVLEGCIA           

     - UNI28722 -  - UNI29258 -  - UNI29258 -  - UNI34726 - 
Transcript ENSMUST00000110400
Sequence
TTTTTTTTTTTTTTTTTTTTTTTGGTACTGCGGGCGCGCGGCAACCTTGGATCAACGCCCCGCTGCTCCGGCCGGCCCACTCTTTCCTTGCAAGCTGCGG

CTTCCTCGCGGAAACATTAAAGGGTCTGAAGAAGGGCGCGGGGCCGAGAGTCAGAGAGTGGGACCCGGGATCTCCCCGCGCCCAGTGGGGCAACCATGAC

CGACGAGAGCTCCGATGTCCCCCGGGAGTTAATGG AAAGCATCAAGGATGTTATTGGCAGGAAGATCAAAATCTCAGTGAAGAAGAAAGTGAAGTTGGA

AGTGAAGGGCGACAGGGTGGAAAACAAAGTGCTG - UNI4295 - - UNI4536 - GTGCTCACATCATGCCGAGCCTTCCTCCTGTCAGCACGCAT

CCCCAGCAAG - UNI4536 - CTCGAGTTAACCTTCAGTTATCTAGAGATTCATGGAGTCATCTGCCACAAGCCAGCCCAG - UNI3853 - ATGG

TTGTGGAGACTGAGAAGTGTAACATGTCCATGAAGATGGTGTCCCCAGAGGATGTGAGTGAAGTGCTGGCTCACATAGGCACCTGCTTGCGGAGGATATT

CCCAGGCCTTTCCCCACT GAGAATCATGAAGAAAGTCTCCATGGAGCCATCTGAACGTCTGGCCAGTCTCCAGGCCCTGTGGGACAGCCAGACCTTGGC

TGAGCCAGGCCCCTGTG GTGGGTTTTCTCAGATGTATGCCTGTGTGTGCGACTGGCTGGGCTTTTCATACAAGGAAGAAGTGCAGTGG GATGTGGATA

CAATTTATCTGACACAAGACACCAGGGAATTAAATTTACAGGACTTCAGTCATCTCGAGCACAG AGACCTGATCCCCATCATTGCTGCCCTGGAGTATA

ACCAGTGGTTCACCAAACTGTCCTCTAAGGATCTCAAACTG TCCACGGATGTTTGTGAACAGATTTTGAGAGTGGTGAGTAGGTCCAATCGACTGGAAG

AGTTGGTGTTGGAAAATGCTGGACTCAGAAT AGATTTTGCACAGAAATTGGCCGGTGCTCTAGCACACAATCCTAACTCAGGACTTCACACAATCAACC

TTGCTGGGAACTCGCTGGAGGATCGAG GTGTGTCCTCCTTAAGTATTCAATTTGCCAAACTCCCAAAGGGATTGAAGCATTTGAACCTCTCTAAAACCT

CATTGTCACCTAAAG GGGTGAACAGCCTTTGTCAGTCCCTCAGTGCCAACCCTCTGACTGCCTCTACCCTCACCCACCTGGACCTCTCAGGGAATGCCC

TCCGCGGAGATGACCTCTCG CACATGTACAATTTTTTGGCCCAGCCCAACACCATTGTTCATCTGGATCTATCTAATACAGAATGTTCTCTGGAGATG 

GTGTGTAGCGCTCTCCTCCGGGGTTGCCTTCAGTGTCTCGCTGTGCTCAATCTCTCCAGATCTGTCTTCTCTCACAG GAAAGGAAAGGAAGTCCCTCCG

TCTTTCAAGCAGTTTTTCAGCAGTTCTCTGGCTTTGATCCAAATCAACCTTTCAGGCACGAAGCTGTCTCCCGAGCCCTTGAA AGCGCTGCTCTTGGGC

CTGGCCTGCAATCATAGCCTGAAGGGAGTCTCTCTGGATCTCAGCAACTGTGAG CTTGGCCACTGT CTGAGGTCAGGAGGAGCTCAAGTGTTAGAAGG

CTGCATCGCTGAAATCCACAACATCACCAGCTTAGATATCTCTGACAATG GTTTAGAATCCGACCTATCTACCCTAATTGTGTGGCTCAGTAAAAACAG

ATCAATACAGCACCTGGCATTGGGCAAAAATTTTAATAATATGAAATCCAA AAATCTGACGCCTGTGTTGGACAACTTAGTGCAGATGATCCAAGATGA

AGACTCT CCTCTGCAGTCGTTGTCCCTGGCTGACTCAAAACTCAAGGCTGAGGTCACCATCATCATCAATGCCCTGGGCAGCAACACCTCCCTGACCAA

AGTGGACATCAGTGGGAATGGCATGGGGGACATGGGAGCGAAGATGCTGGCCAAGGCTCTCCAGATCAACACCAAACTCAG GACAGTCATCTGGGACAA

AAACAACATCACTGCACAAGGCTTTCAAGACATAGCTGTTGCTATGGAAAA GAACTACACACTGCGATTTATGCCAATTCCGATGTATGATGCCGCTCA

AGCTCTCAAAACCAACCCCGAGAAAACAGAAGAGGCTCTGCAGAAG ATAGAAAATTATCTGCTCCGGAATCACGAGACCAGGAAATACCTTCAGGAGCA

GGCCTATCGCCTCCAGCAGGGCATCGTCACCAGCACCACCCAGCAG ATGATTGACCGGATATGTGTGAAGGTTCAGGATCACCTCAACTCCTTACGAGC

CTGTGGGGGTGATGCTATTCAGGAGGATTTAAAGGCAGCGGAGCGGCTCATGCGAGATGCTAAGAACTCTAAAACA TTGTTGCCCAATTTATATCATGT

GGGCGGTGCATCCTGGGCAGGAGCCAGTGGGCTGTCATCCAGTCCCATTCAGGAGACCCTGGAGTCGATGGCTGGAGAAGTCACAAGAGTGGTGGATGAA

CAACTGAAG GATTTGCTAGAATCCATGGTGGACGCAGCCGAGACCCTCTGCCCCAACGTCATGAGAAAAGCCCACATCCGACAGGACCTGATCCATGCC

AGCACCGAAAAGATTTCCATCCCACGTACCTTTGTTAAAAATGTCCTGTTGGAACAGTCCGGGATTGACATTCTTAACAAAATCAG TGAGGTGAAGCTG

ACAGTGGCCTCGTTCTTGTCTGACCGGATCGTCGATGAGATCCTGGATTCTCTCTCCAGCAGCCATCGGAAGCTG GCCAACCATTTCAGCAGGCTAAAC

AAGAGCCTTCCCCAGCGAGAGGACCTAGAGGTGGAGCTGGTGGAGGAGAAGCCGGTGAAACGGGCCATCCTCACGGTAGAGGATCTCACAGAGGTGGAGA

GGCTGGAAGACCTAGACACTTGTATG ACTCTCTGCTGTACAAGT ATGACTCCTAAGTCCAAGAGGAAGAGCATCCACAGCCGAATGCTGCGGCCTGTC

TCCAGGGCCTTCG AAATGGAGTTTGATCTTGATAAAGCCCTGGAAGAGGTGCCGATTCACATCGAAGACCCACCTTTCCCATCAGTCCGGCAAGAGAAG

CGAAGCTCGGGGTTAATCTCTGAGCTGCCCTCGGAGGAAGGCAGGAGACTGGAACACTTCACCAAGTTAAGGCCCAAGCGGAACAAGAAGCAGCAACCTA

CGCAAGCAGCG GTCTGTACCATCAGCATCTTGCCCCAGGATGGAGAACAGAATGGCCTCATGGGCAGAGTGGATGAAGGGGTAGATGAGTTTTTCACCA

AGAAGGTGACTAAAATGGATTGCAA GAGGTCATCCTCGCGCTCCTCAGATGCCCACGAACTCGGGGAAGGAGATGAGAAGAAAAAACGGGACTCTCGGA

GGAGTGGCTTCCTCAACCTGATTAAATCCAGGTCCAGATCTGAGCGGCCACCCACAGTCCTGATGACGGAAGAGCTCTCCTCCCCGAAAGGGGCAATGCG

GAGCCCACCAGTGGATACCACCAGGAAGGAGATAAAGGCAGCGGAGCACAATGGTGCTCCAGACCGCACAGAAGAGATTAAGACACCGGAACCCCTGGAG

GAGGGTCCAGCAGAGGAAGCTGGCAGGGCTGAGCGCAGTGACAGCAGGGGCAGCCCGCAGGGTGGCCGGCGCTATGTGCAGGTGATGGGCAGCGGCCTGC

TGGCCGAGATGAAGGCCAAGCAGGAGCGGAGGGCAGCATGTGCACAGAAG - UNI28722 - AAGCTCGGCAATGATGTCATCTCCCAGGATCCTTCC

AGCCCAGTCTCGTGCAACACAGAGCGTTTAGAAGGAGGGGCGACAG - UNI29258 - TGCCTAAACTGCAACCAGGTCTTCCAGAGGCCCGCTTTGG

TTCGGGAACACCAGAAAAGAATGCCAAAGCTGAACCCAGAGTGGATGGAGGCTGCAGGTCCCGGAGCTCCTCCAGCATGCCCACCAGCCCAAAGCCCCTC

CTTCAGTCCCCTAAGCCCAGCCCTTCAGCCCGGCCTTCTATCCCTCAGAAGCCAAGAACTGCCTCCCGACCTG - UNI29258 - AAGACACCCCAGA

CTCTCCATCTGGTCCTAGTTCCCCTAAAGTTGCCCTCCTTCCACCCATCCTCAAAAAAGTCTCCTCGGACAAGGAGCGTGACGGCCAGAACAGCTCACAG

TCCAGTCCTAGGAGCTTCTCCCAGGAAG CGTGCCCAACTAATTTCTGA
Translation
  - UNI4295 - - UNI4536 -  - UNI4536 -  - UNI3853 -                MKSK KNLTPVLDNLVQMIQDEDS PLQSLSLA

DSKLKAEVTIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTKLR RTVIWDKNNITAQGFQDIAVAMEK KNYTLRFMPIPMYDAAQALKTNPE

KTEEALQK IENYLLRNHETRKYLQEQAYRLQQGIVTSTTQQ MIDRICVKVQDHLNSLRACGGDAIQEDLKAAERLMRDAKNSKT LLPNLYHVGGASW

AGASGLSSSPIQETLESMAGEVTRVVDEQLK DLLESMVDAAETLCPNVMRKAHIRQDLIHASTEKISIPRTFVKNVLLEQSGIDILNKIS SEVKLTVA

SFLSDRIVDEILDSLSSSHRKL ANHFSRLNKSLPQREDLEVELVEEKPVKRAILTVEDLTEVERLEDLDTCM TLCCTS MTPKSKRKSIHSRMLRPVS

RAFE EMEFDLDKALEEVPIHIEDPPFPSVRQEKRSSGLISELPSEEGRRLEHFTKLRPKRNKKQQPTQAA VCTISILPQDGEQNGLMGRVDEGVDEFF

TKKVTKMDCK KRSSSRSSDAHELGEGDEKKKRDSRRSGFLNLIKSRSRSERPPTVLMTEELSSPKGAMRSPPVDTTRKEIKAAEHNGAPDRTEEIKTPE

PLEEGPAEEAGRAERSDSRGSPQGGRRYVQVMGSGLLAEMKAKQERRAACAQK - UNI28722 - KLGNDVISQDPSSPVSCNTERLEGGATV - UN

I29258 - VPKLQPGLPEARFGSGTPEKNAKAEPRVDGGCRSRSSSSMPTSPKPLLQSPKPSPSARPSIPQKPRTASRPE - UNI29258 - EDTPD

SPSGPSSPKVALLPPILKKVSSDKERDGQNSSQSSPRSFSQEA ACPTNF
Transcript ENSMUST00000021771
Sequence
GCTGGCCAAGGCTCTCCAGATCAACACCAAACTCAG GACAGTCATCTGGGACAAAAACAACATCACTGCACAAGGCTTTCAAGACATAGCTGTTGCTAT

GGAAAA GAACTACACACTGCGATTTATGCCAATTCCGATGTATGATGCCGCTCAAGCTCTCAAAACCAACCCCGAGAAAACAGAAGAGGCTCTGCAGAA

G ATAGAAAATTATCTGCTCCGGAATCACGAGACCAGGAAATACCTTCAGGAGCAGGCCTATCGCCTCCAGCAGGGCATCGTCACCAGCACCACCCAGCA

G ATGATTGACCGGATATGTGTGAAGGTTCAGGATCACCTCAACTCCTTACGAGCCTGTGGGGGTGATGCTATTCAGGAGGATTTAAAGGCAGCGGAGCG

GCTCATGCGAGATGCTAAGAACTCTAAAACA TTGTTGCCCAATTTATATCATGTGGGCGGTGCATCCTGGGCAGGAGCCAGTGGGCTGTCATCCAGTCC

CATTCAGGAGACCCTGGAGTCGATGGCTGGAGAAGTCACAAGAGTGGTGGATGAACAACTGAAG GATTTGCTAGAATCCATGGTGGACGCAGCCGAGAC

CCTCTGCCCCAACGTCATGAGAAAAGCCCACATCCGACAGGACCTGATCCATGCCAGCACCGAAAAGATTTCCATCCCACGTACCTTTGTTAAAAATGTC

CTGTTGGAACAGTCCGGGATTGACATTCTTAACAAAATCAG TGAGGTGAAGCTGACAGTGGCCTCGTTCTTGTCTGACCGGATCGTCGATGAGATCCTG

GATTCTCTCTCCAGCAGCCATCGGAAGCTG GCCAACCATTTCAGCAGGCTAAACAAGAGCCTTCCCCAGCGAGAGGACCTAGAGGTGGAGCTGGTGGAG

GAGAAGCCGGTGAAACGGGCCATCCTCACGGTAGAGGATCTCACAGAGGTGGAGAGGCTGGAAGACCTAGACACTTGTATG ATGACTCCTAAGTCCAAG

AGGAAGAGCATCCACAGCCGAATGCTGCGGCCTGTCTCCAGGGCCTTCG AAATGGAGTTTGATCTTGATAAAGCCCTGGAAGAGGTGCCGATTCACATC

GAAGACCCACCTTTCCCATCAGTCCGGCAAGAGAAGCGAAGCTCGGGGTTAATCTCTGAGCTGCCCTCGGAGGAAGGCAGGAGACTGGAACACTTCACCA

AGTTAAGGCCCAAGCGGAACAAGAAGCAGCAACCTACGCAAGCAGCG GTCTGTACCATCAGCATCTTGCCCCAGGATGGAGAACAGAATGGCCTCATGG

GCAGAGTGGATGAAGGGGTAGATGAGTTTTTCACCAAGAAGGTGACTAAAATGGATTGCAA GAGGTCATCCTCGCGCTCCTCAGATGCCCACGAACTCG

GGGAAGGAGATGAGAAGAAAAAACGGGACTCTCGGAGGAGTGGCTTCCTCAACCTGATTAAATCCAGGTCCAGATCTGAGCGGCCACCCACAGTCCTGAT

GACGGAAGAGCTCTCCTCCCCGAAAGGGGCAATGCGGAGCCCACCAGTGGATACCACCAGGAAGGAGATAAAGGCAGCGGAGCACAATGGTGCTCCAGAC

CGCACAGAAGAGATTAAGACACCGGAACCCCTGGAGGAGGGTCCAGCAGAGGAAGCTGGCAGGGCTGAGCGCAGTGACAGCAGGGGCAGCCCGCAGGGTG

GCCGGCGCTATGTGCAGGTGATGGGCAGCGGCCTGCTGGCCGAGATGAAGGCCAAGCAGGAGCGGAGGGCAGCATGTGCACAGAAG - UNI28722 - 

AAGCTCGGCAATGATGTCATCTCCCAGGATCCTTCCAGCCCAGTCTCGTGCAACACAGAGCGTTTAGAAGGAGGGGCGACAG - UNI29258 - TGCC

TAAACTGCAACCAGGTCTTCCAGAGGCCCGCTTTGGTTCGGGAACACCAGAAAAGAATGCCAAAGCTGAACCCAGAGTGGATGGAGGCTGCAGGTCCCGG

AGCTCCTCCAGCATGCCCACCAGCCCAAAGCCCCTCCTTCAGTCCCCTAAGCCCAGCCCTTCAGCCCGGCCTTCTATCCCTCAGAAGCCAAGAACTGCCT

CCCGACCTG - UNI29258 - AAGACACCCCAGACTCTCCATCTGGTCCTAGTTCCCCTAAAGTTGCCCTCCTTCCACCCATCCTCAAAAAAGTCTCC

TCGGACAAGGAGCGTGACGGCCAGAACAGCTCACAGTCCAGTCCTAGGAGCTTCTCCCAGGAAG - UNI34726 - TGCAAAGAGGAGATTATTTCAA

AAGGCATTCAGATCATGACAGTGGGAAGCCTTCCAGTAGAGGGAAAAGATCTTCAAAACTCTACTTCGCCATTGCAGAAGAGGAAGCGAATGCACCTGGG

TACAGGAAGTCACAGCCAACAAATG - UNI34726 - CCTCAAGGAGAAGCTGGGGCCCGGCCCAGGAGTATCAAGAACAGAAGCAACGGTCCTCGGG

CAAAGATGGTCACCAAGGGAGCAAATGCAGTGACTCTGGAGAAGAGGCAGAAAAAGAGTTTATTTTTGTGTAATGGTGCCCACCCCAAGCCTCTCCATGC

AGGGCGCTCTCCTCAGCTCTCAGAGAGGAGCCAGGGCCAGTACCTCTTCTCTCTTCTCTTGGTGCTTTCTTCTTTCTCTCCTTTCTTCTTTCTCATTTAT

ATATATTTTCAAATTTTTGGTCTTCCCCCATTCTTGGCATTTGATTTCTAAACACTGTTTCTTATGCCTTCAACAAAAAGCCAGCAATTATTCCATGGGC

CCTACTTGAATTTCTCTGAGGCAGCTACACATTGCCCTGCATGGTGAGTTGTTTTTGGAAATTAATGAAGTAACTGGACTCACACCCAAGTAACAATCCG

GGAGGTCCTGGGGTGCTACAGGGTGTGTTTGTGTCAGATCCACACATAACTCGATAGAGCAATTTATTCTTGATGTATGCAATTGCACATTGTAATTATA

TTAACAGAGCACACTAATAAATAATTTGTATAAATTATAAATATTAGATCTTGGGCACAGTTCTTACATTCTTTTGTGGGACATTTCCTTCCCCATGTAG

AATTGTACATTTAAACCTTGGTTGGTAATATTTGCAGACCATCGGCAAGCACAGCTAAAAACAGTGTGAGAAGCTCAGATTCATGTATATACTTGATTGG

AATGAGGTCTTATAAATATTCATGTTTCTGAAGGCCTTT
Translation
             - UNI28722 -  - UNI29258 - MPTSPKPLLQSPKPSPSARPSIPQKPRTASRPE - UNI29258 - EDTPDSPSGPSSP

KVALLPPILKKVSSDKERDGQNSSQSSPRSFSQEV - UNI34726 - VQRGDYFKRHSDHDSGKPSSRGKRSSKLYFAIAEEEANAPGYRKSQPTNA 

- UNI34726 - ASRRSWGPAQEYQEQKQRSSGKDGHQGSKCSDSGEEAEKEFIFV
Transcript ENSMUST00000060540
Sequence
GCTGGCCAAGGCTCTCCAGATCAACACCAAACTCAG GACAGTCATCTGGGACAAAAACAACATCACTGCACAAGGCTTTCAAGACATAGCTGTTGCTAT

GGAAAA GAACTACACACTGCGATTTATGCCAATTCCGATGTATGATGCCGCTCAAGCTCTCAAAACCAACCCCGAGAAAACAGAAGAGGCTCTGCAGAA

G ATAGAAAATTATCTGCTCCGGAATCACGAGACCAGGAAATACCTTCAGGAGCAGGCCTATCGCCTCCAGCAGGGCATCGTCACCAGCACCACCCAGCA

G ATGATTGACCGGATATGTGTGAAGGTTCAGGATCACCTCAACTCCTTACGAGCCTGTGGGGGTGATGCTATTCAGGAGGATTTAAAGGCAGCGGAGCG

GCTCATGCGAGATGCTAAGAACTCTAAAACA TTGTTGCCCAATTTATATCATGTGGGCGGTGCATCCTGGGCAGGAGCCAGTGGGCTGTCATCCAGTCC

CATTCAGGAGACCCTGGAGTCGATGGCTGGAGAAGTCACAAGAGTGGTGGATGAACAACTGAAG GATTTGCTAGAATCCATGGTGGACGCAGCCGAGAC

CCTCTGCCCCAACGTCATGAGAAAAGCCCACATCCGACAGGACCTGATCCATGCCAGCACCGAAAAGATTTCCATCCCACGTACCTTTGTTAAAAATGTC

CTGTTGGAACAGTCCGGGATTGACATTCTTAACAAAATCAG TGAGGTGAAGCTGACAGTGGCCTCGTTCTTGTCTGACCGGATCGTCGATGAGATCCTG

GATTCTCTCTCCAGCAGCCATCGGAAGCTG GCCAACCATTTCAGCAGGCTAAACAAGAGCCTTCCCCAGCGAGAGGACCTAGAGGTGGAGCTGGTGGAG

GAGAAGCCGGTGAAACGGGCCATCCTCACGGTAGAGGATCTCACAGAGGTGGAGAGGCTGGAAGACCTAGACACTTGTATG ATGACTCCTAAGTCCAAG

AGGAAGAGCATCCACAGCCGAATGCTGCGGCCTGTCTCCAGGGCCTTCG AAATGGAGTTTGATCTTGATAAAGCCCTGGAAGAGGTGCCGATTCACATC

GAAGACCCACCTTTCCCATCAGTCCGGCAAGAGAAGCGAAGCTCGGGGTTAATCTCTGAGCTGCCCTCGGAGGAAGGCAGGAGACTGGAACACTTCACCA

AGTTAAGGCCCAAGCGGAACAAGAAGCAGCAACCTACGCAAGCAGCG GTCTGTACCATCAGCATCTTGCCCCAGGATGGAGAACAGAATGGCCTCATGG

GCAGAGTGGATGAAGGGGTAGATGAGTTTTTCACCAAGAAGGTGACTAAAATGGATTGCAA GAGGTCATCCTCGCGCTCCTCAGATGCCCACGAACTCG

GGGAAGGAGATGAGAAGAAAAAACGGGACTCTCGGAGGAGTGGCTTCCTCAACCTGATTAAATCCAGGTCCAGATCTGAGCGGCCACCCACAGTCCTGAT

GACGGAAGAGCTCTCCTCCCCGAAAGGGGCAATGCGGAGCCCACCAGTGGATACCACCAGGAAGGAGATAAAGGCAGCGGAGCACAATGGTGCTCCAGAC

CGCACAGAAGAGATTAAGACACCGGAACCCCTGGAGGAGGGTCCAGCAGAGGAAGCTGGCAGGGCTGAGCGCAGTGACAGCAGGGGCAGCCCGCAGGGTG

GCCGGCGCTATGTGCAGGTGATGGGCAGCGGCCTGCTGGCCGAGATGAAGGCCAAGCAGGAGCGGAGGGCAGCATGTGCACAGAAG - UNI28722 - 

AAGCTCGGCAATGATGTCATCTCCCAGGATCCTTCCAGCCCAGTCTCGTGCAACACAGAGCGTTTAGAAGGAGGGGCGACAG - UNI29258 - TGCC

TAAACTGCAACCAGGTCTTCCAGAGGCCCGCTTTGGTTCGGGAACACCAGAAAAGAATGCCAAAGCTGAACCCAGAGTGGATGGAGGCTGCAGGTCCCGG

AGCTCCTCCAGCATGCCCACCAGCCCAAAGCCCCTCCTTCAGTCCCCTAAGCCCAGCCCTTCAGCCCGGCCTTCTATCCCTCAGAAGCCAAGAACTGCCT

CCCGACCTG - UNI29258 - AAGACACCCCAGACTCTCCATCTGGTCCTAGTTCCCCTAAAGTTGCCCTCCTTCCACCCATCCTCAAAAAAGTCTCC

TCGGACAAGGAGCGTGACGGCCAGAACAGCTCACAGTCCAGTCCTAGGAGCTTCTCCCAGGAAG CGTGCCCAACTAATTTCTGAAACAG - UNI3472

6 - CCTCAAGGAGAAGCTGGGGCCCGGCCCAGGAGTATCAAGAACAGAAGCAACGGTCCTCGGGCAAAGATGGTCACCAAGGGAGCAAATGCAGTGACT

CTGGAGAAGAGGCAGAAAAAGAGTTTATTTTTGTGTAATGGTGCCCACCCCAAGCCTCTCCATGCAGGGCGCTCTCCTCAGCTCTCAGAGAGGAGCCAGG

GCCAGTACCTCTTCTCTCTTCTCTTGGTGCTTTCTTCTTTCTCTCCTTTCTTCTTTCTCATTTATATATATTTTCAAATTTTTGGTCTTCCCCCATTCTT

GGCATTTGATTTCTAAACACTGTTTCTTATGCCTTCAACAAAAAGCCAGCAATTATTCCATGGGCCCTACTTGAATTTCTCTGAGGCAGCTACACATTGC

CCTGCATGGTGAGTTGTTTTTGGAAATTAATGAAGTAACTGGACTCACACCCAAGTAACAATCCGGGAGGTCCTGGGGTGCTACAGGGTGTGTTTGTGTC

AGATCCACACATAACTCGATAGAGCAATTTATTCTTGATGTATGCAATTGCACATTGTAATTATATTAACAGAGCACACTAATAAATAATTTGTATAAAT

TATAAATATTAGATCTTGGGCACAGTTCTTACATTCTTTTGTGGGACATTTCCTTCCCCATGTAGAATTGTACATTTAAACCTTGGTTGGTAATATTTGC

AGACCATCGGCAAGCACAGCTAAAAACAGTGTGAGAAGCTCAGATTCATGTATATACTTGATTGGAATGAGGTCTTATAAATATTCATGTTTCTGAAGGC

CTTT
Translation
             - UNI28722 -  - UNI29258 - MEAAGPGAPPACPPAQSPSFSPLSPALQPGLLSLRSQELPPDL - UNI29258 - KTP

QTLHLVLVPLKLPSFHPSSKKSPRTRSVTARTAHSPVLGASPRK RAQLISETA - UNI34726 - ASRRSWGPAQEYQEQKQRSSGKDGHQGSKCSD

SGEEAEKEFIFV
Transcript ENSMUST00000110402
Sequence
TTTTTTTTTTTTTTTTTTTTTTTGGTACTGCGGGCGCGCGGCAACCTTGGATCAACGCCCCGCTGCTCCGGCCGGCCCACTCTTTCCTTGCAAGCTGCGG

CTTCCTCGCGGAAACATTAAAGGGTCTGAAGAAGGGCGCGGGGCCGAGAGTCAGAGAGTGGGACCCGGGATCTCCCCGCGCCCAGTGGGGCAACCATGAC

CGACGAGAGCTCCGATGTCCCCCGGGAGTTAATGG AAAGCATCAAGGATGTTATTGGCAGGAAGATCAAAATCTCAGTGAAGAAGAAAGTGAAGTTGGA

AGTGAAGGGCGACAGGGTGGAAAACAAAGTGCTG - UNI4295 - - UNI4536 - GTGCTCACATCATGCCGAGCCTTCCTCCTGTCAGCACGCAT

CCCCAGCAAG - UNI4536 - CTCGAGTTAACCTTCAGTTATCTAGAGATTCATGGAGTCATCTGCCACAAGCCAGCCCAG - UNI3853 - ATGG

TTGTGGAGACTGAGAAGTGTAACATGTCCATGAAGATGGTGTCCCCAGAGGATGTGAGTGAAGTGCTGGCTCACATAGGCACCTGCTTGCGGAGGATATT

CCCAGGCCTTTCCCCACT GAGAATCATGAAGAAAGTCTCCATGGAGCCATCTGAACGTCTGGCCAGTCTCCAGGCCCTGTGGGACAGCCAGACCTTGGC

TGAGCCAGGCCCCTGTG GTGGGTTTTCTCAGATGTATGCCTGTGTGTGCGACTGGCTGGGCTTTTCATACAAGGAAGAAGTGCAGTGG GATGTGGATA

CAATTTATCTGACACAAGACACCAGGGAATTAAATTTACAGGACTTCAGTCATCTCGAGCACAG AGACCTGATCCCCATCATTGCTGCCCTGGAGTATA

ACCAGTGGTTCACCAAACTGTCCTCTAAGGATCTCAAACTG TCCACGGATGTTTGTGAACAGATTTTGAGAGTGGTGAGTAGGTCCAATCGACTGGAAG

AGTTGGTGTTGGAAAATGCTGGACTCAGAAT AGATTTTGCACAGAAATTGGCCGGTGCTCTAGCACACAATCCTAACTCAGGACTTCACACAATCAACC

TTGCTGGGAACTCGCTGGAGGATCGAG GTGTGTCCTCCTTAAGTATTCAATTTGCCAAACTCCCAAAGGGATTGAAGCATTTGAACCTCTCTAAAACCT

CATTGTCACCTAAAG GGGTGAACAGCCTTTGTCAGTCCCTCAGTGCCAACCCTCTGACTGCCTCTACCCTCACCCACCTGGACCTCTCAGGGAATGCCC

TCCGCGGAGATGACCTCTCG CACATGTACAATTTTTTGGCCCAGCCCAACACCATTGTTCATCTGGATCTATCTAATACAGAATGTTCTCTGGAGATG 

GTGTGTAGCGCTCTCCTCCGGGGTTGCCTTCAGTGTCTCGCTGTGCTCAATCTCTCCAGATCTGTCTTCTCTCACAG GAAAGGAAAGGAAGTCCCTCCG

TCTTTCAAGCAGTTTTTCAGCAGTTCTCTGGCTTTGATCCAAATCAACCTTTCAGGCACGAAGCTGTCTCCCGAGCCCTTGAA AGCGCTGCTCTTGGGC

CTGGCCTGCAATCATAGCCTGAAGGGAGTCTCTCTGGATCTCAGCAACTGTGAG CTTGGCCACTGT CTGAGGTCAGGAGGAGCTCAAGTGTTAGAAGG

CTGCATCGCTGAAATCCACAACATCACCAGCTTAGATATCTCTGACAATG GTTTAGAATCCGACCTATCTACCCTAATTGTGTGGCTCAGTAAAAACAG

ATCAATACAGCACCTGGCATTGGGCAAAAATTTTAATAATATGAAATCCAA AAATCTGACGCCTGTGTTGGACAACTTAGTGCAGATGATCCAAGATGA

AGACTCT CCTCTGCAGTCGTTGTCCCTGGCTGACTCAAAACTCAAGGCTGAGGTCACCATCATCATCAATGCCCTGGGCAGCAACACCTCCCTGACCAA

AGTGGACATCAGTGGGAATGGCATGGGGGACATGGGAGCGAAGATGCTGGCCAAGGCTCTCCAGATCAACACCAAACTCAG GACAGTCATCTGGGACAA

AAACAACATCACTGCACAAGGCTTTCAAGACATAGCTGTTGCTATGGAAAA GAACTACACACTGCGATTTATGCCAATTCCGATGTATGATGCCGCTCA

AGCTCTCAAAACCAACCCCGAGAAAACAGAAGAGGCTCTGCAGAAG ATAGAAAATTATCTGCTCCGGAATCACGAGACCAGGAAATACCTTCAGGAGCA

GGCCTATCGCCTCCAGCAGGGCATCGTCACCAGCACCACCCAGCAG ATGATTGACCGGATATGTGTGAAGGTTCAGGATCACCTCAACTCCTTACGAGC

CTGTGGGGGTGATGCTATTCAGGAGGATTTAAAGGCAGCGGAGCGGCTCATGCGAGATGCTAAGAACTCTAAAACA TTGTTGCCCAATTTATATCATGT

GGGCGGTGCATCCTGGGCAGGAGCCAGTGGGCTGTCATCCAGTCCCATTCAGGAGACCCTGGAGTCGATGGCTGGAGAAGTCACAAGAGTGGTGGATGAA

CAACTGAAG GATTTGCTAGAATCCATGGTGGACGCAGCCGAGACCCTCTGCCCCAACGTCATGAGAAAAGCCCACATCCGACAGGACCTGATCCATGCC

AGCACCGAAAAGATTTCCATCCCACGTACCTTTGTTAAAAATGTCCTGTTGGAACAGTCCGGGATTGACATTCTTAACAAAATCAG TGAGGTGAAGCTG

ACAGTGGCCTCGTTCTTGTCTGACCGGATCGTCGATGAGATCCTGGATTCTCTCTCCAGCAGCCATCGGAAGCTG GCCAACCATTTCAGCAGGCTAAAC

AAGAGCCTTCCCCAGCGAGAGGACCTAGAGGTGGAGCTGGTGGAGGAGAAGCCGGTGAAACGGGCCATCCTCACGGTAGAGGATCTCACAGAGGTGGAGA

GGCTGGAAGACCTAGACACTTGTATG ATGACTCCTAAGTCCAAGAGGAAGAGCATCCACAGCCGAATGCTGCGGCCTGTCTCCAGGGCCTTCG AAATG

GAGTTTGATCTTGATAAAGCCCTGGAAGAGGTGCCGATTCACATCGAAGACCCACCTTTCCCATCAGTCCGGCAAGAGAAGCGAAGCTCGGGGTTAATCT

CTGAGCTGCCCTCGGAGGAAGGCAGGAGACTGGAACACTTCACCAAGTTAAGGCCCAAGCGGAACAAGAAGCAGCAACCTACGCAAGCAGCG GTCTGTA

CCATCAGCATCTTGCCCCAGGATGGAGAACAGAATGGCCTCATGGGCAGAGTGGATGAAGGGGTAGATGAGTTTTTCACCAAGAAGGTGACTAAAATGGA

TTGCAA GAGGTCATCCTCGCGCTCCTCAGATGCCCACGAACTCGGGGAAGGAGATGAGAAGAAAAAACGGGACTCTCGGAGGAGTGGCTTCCTCAACCT

GATTAAATCCAGGTCCAGATCTGAGCGGCCACCCACAGTCCTGATGACGGAAGAGCTCTCCTCCCCGAAAGGGGCAATGCGGAGCCCACCAGTGGATACC

ACCAGGAAGGAGATAAAGGCAGCGGAGCACAATGGTGCTCCAGACCGCACAGAAGAGATTAAGACACCGGAACCCCTGGAGGAGGGTCCAGCAGAGGAAG

CTGGCAGGGCTGAGCGCAGTGACAGCAGGGGCAGCCCGCAGGGTGGCCGGCGCTATGTGCAGGTGATGGGCAGCGGCCTGCTGGCCGAGATGAAGGCCAA

GCAGGAGCGGAGGGCAGCATGTGCACAGAAG - UNI28722 - AAGCTCGGCAATGATGTCATCTCCCAGGATCCTTCCAGCCCAGTCTCGTGCAACA

CAGAGCGTTTAGAAGGAGGGGCGACAG - UNI29258 - TGCCTAAACTGCAACCAGGTCTTCCAGAGGCCCGCTTTGGTTCGGGAACACCAGAAAAG

AATGCCAAAGCTGAACCCAGAGTGGATGGAGGCTGCAGGTCCCGGAGCTCCTCCAGCATGCCCACCAGCCCAAAGCCCCTCCTTCAGTCCCCTAAGCCCA

GCCCTTCAGCCCGGCCTTCTATCCCTCAGAAGCCAAGAACTGCCTCCCGACCTG - UNI29258 - AAGACACCCCAGACTCTCCATCTGGTCCTAGT

TCCCCTAAAGTTGCCCTCCTTCCACCCATCCTCAAAAAAGTCTCCTCGGACAAGGAGCGTGACGGCCAGAACAGCTCACAGTCCAGTCCTAGGAGCTTCT

CCCAGGAAG - UNI34726 - CCTCAAGGAGAAGCTGGGGCCCGGCCCAGGAGTATCAAGAACAGAAGCAACGGTCCTCGGGCAAAGATGGTCACCAA

GGGAGCAAATGCAGTGACTCTGGAGAAGAGGCAGAAAAAGAGTTTATTTTTGTGTAATGGTGCCCACCCCAAGCCTCTCCATGCAGGGCGCTCTCCTCAG

CTCTCAGAGAGGAGCCAGGGCCAGTACCTCTTCTCTCTTCTCTTGGTGCTTTCTTCTTTCTCTCCTTTCTTCTTTCTCATTTATATATATTTTCAAATTT

TTGGTCTTCCCCCATTCTTGGCATTTGATTTCTAAACACTGTTTCTTATGCCTTCAACAAAAAGCCAGCAATTATTCCATGGGCCCTACTTGAATTTCTC

TGAGGCAGCTACACATTGCCCTGCATGGTGAGTTGTTTTTGGAAATTAATGAAGTAACTGGACTCACACCCAAGTAACAATCCGGGAGGTCCTGGGGTGC

TACAGGGTGTGTTTGTGTCAGATCCACACATAACTCGATAGAGCAATTTATTCTTGATGTATGCAATTGCACATTGTAATTATATTAACAGAGCACACTA

ATAAATAATTTGTATAAATTATAAATATTAGATCTTGGGCACAGTTCTTACATTCTTTTGTGGGACATTTCCTTCCCCATGTAGAATTGTACATTTAAAC

CTTGGTTGGTAATATTTGCAGACCATCGGCAAGCACAGCTAAAAACAGTGTGAGAAGCTCAGATTCATGTATATACTTGATTGGAATGAGGTCTTATAAA

TATTCATGTTTCTGAAGGCCTTT
Translation
ME ESIKDVIGRKIKISVKKKVKLEVKGDRVENKVL - UNI4295 - - UNI4536 - VLTSCRAFLLSARIPSK - UNI4536 - LELTFSYLE

IHGVICHKPAQ - UNI3853 - MVVETEKCNMSMKMVSPEDVSEVLAHIGTCLRRIFPGLSPL LRIMKKVSMEPSERLASLQALWDSQTLAEPGPCG

 GGFSQMYACVCDWLGFSYKEEVQW DVDTIYLTQDTRELNLQDFSHLEHR RDLIPIIAALEYNQWFTKLSSKDLKL STDVCEQILRVVSRSNRLEEL

VLENAGLRI IDFAQKLAGALAHNPNSGLHTINLAGNSLEDRG GVSSLSIQFAKLPKGLKHLNLSKTSLSPKG GVNSLCQSLSANPLTASTLTHLDLS

GNALRGDDLS HMYNFLAQPNTIVHLDLSNTECSLEM VCSALLRGCLQCLAVLNLSRSVFSHR RKGKEVPPSFKQFFSSSLALIQINLSGTKLSPEPL

K KALLLGLACNHSLKGVSLDLSNCE LGHC LRSGGAQVLEGCIAEIHNITSLDISDNG GLESDLSTLIVWLSKNRSIQHLALGKNFNNMKSK KNLT

PVLDNLVQMIQDEDS PLQSLSLADSKLKAEVTIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTKLR RTVIWDKNNITAQGFQDIAVAMEK 

KNYTLRFMPIPMYDAAQALKTNPEKTEEALQK IENYLLRNHETRKYLQEQAYRLQQGIVTSTTQQ MIDRICVKVQDHLNSLRACGGDAIQEDLKAAER

LMRDAKNSKT LLPNLYHVGGASWAGASGLSSSPIQETLESMAGEVTRVVDEQLK DLLESMVDAAETLCPNVMRKAHIRQDLIHASTEKISIPRTFVKN

VLLEQSGIDILNKIS SEVKLTVASFLSDRIVDEILDSLSSSHRKL ANHFSRLNKSLPQREDLEVELVEEKPVKRAILTVEDLTEVERLEDLDTCM MT

PKSKRKSIHSRMLRPVSRAFE EMEFDLDKALEEVPIHIEDPPFPSVRQEKRSSGLISELPSEEGRRLEHFTKLRPKRNKKQQPTQAA VCTISILPQDG

EQNGLMGRVDEGVDEFFTKKVTKMDCK KRSSSRSSDAHELGEGDEKKKRDSRRSGFLNLIKSRSRSERPPTVLMTEELSSPKGAMRSPPVDTTRKEIKA

AEHNGAPDRTEEIKTPEPLEEGPAEEAGRAERSDSRGSPQGGRRYVQVMGSGLLAEMKAKQERRAACAQK - UNI28722 - KLGNDVISQDPSSPVS

CNTERLEGGATV - UNI29258 - VPKLQPGLPEARFGSGTPEKNAKAEPRVDGGCRSRSSSSMPTSPKPLLQSPKPSPSARPSIPQKPRTASRPE -

 UNI29258 - EDTPDSPSGPSSPKVALLPPILKKVSSDKERDGQNSSQSSPRSFSQEA - UNI34726 - ASRRSWGPAQEYQEQKQRSSGKDGHQ

GSKCSDSGEEAEKEFIFV
Transcript ENSMUST00000072889
Sequence
TTTTTTTTTTTTTTTTTTTTTTTGGTACTGCGGGCGCGCGGCAACCTTGGATCAACGCCCCGCTGCTCCGGCCGGCCCACTCTTTCCTTGCAAGCTGCGG

CTTCCTCGCGGAAACATTAAAGGGTCTGAAGAAGGGCGCGGGGCCGAGAGTCAGAGAGTGGGACCCGGGATCTCCCCGCGCCCAGTGGGGCAACCATGAC

CGACGAGAGCTCCGATGTCCCCCGGGAGTTAATGG AAAGCATCAAGGATGTTATTGGCAGGAAGATCAAAATCTCAGTGAAGAAGAAAGTGAAGTTGGA

AGTGAAGGGCGACAGGGTGGAAAACAAAGTGCTG - UNI4295 - - UNI4536 - GTGCTCACATCATGCCGAGCCTTCCTCCTGTCAGCACGCAT

CCCCAGCAAG - UNI4536 - CTCGAGTTAACCTTCAGTTATCTAGAGATTCATGGAGTCATCTGCCACAAGCCAGCCCAG - UNI3853 - ATGG

TTGTGGAGACTGAGAAGTGTAACATGTCCATGAAGATGGTGTCCCCAGAGGATGTGAGTGAAGTGCTGGCTCACATAGGCACCTGCTTGCGGAGGATATT

CCCAGGCCTTTCCCCACT GAGAATCATGAAGAAAGTCTCCATGGAGCCATCTGAACGTCTGGCCAGTCTCCAGGCCCTGTGGGACAGCCAGACCTTGGC

TGAGCCAGGCCCCTGTG GTGGGTTTTCTCAGATGTATGCCTGTGTGTGCGACTGGCTGGGCTTTTCATACAAGGAAGAAGTGCAGTGG GATGTGGATA

CAATTTATCTGACACAAGACACCAGGGAATTAAATTTACAGGACTTCAGTCATCTCGAGCACAG AGACCTGATCCCCATCATTGCTGCCCTGGAGTATA

ACCAGTGGTTCACCAAACTGTCCTCTAAGGATCTCAAACTG TCCACGGATGTTTGTGAACAGATTTTGAGAGTGGTGAGTAGGTCCAATCGACTGGAAG

AGTTGGTGTTGGAAAATGCTGGACTCAGAAT AGATTTTGCACAGAAATTGGCCGGTGCTCTAGCACACAATCCTAACTCAGGACTTCACACAATCAACC

TTGCTGGGAACTCGCTGGAGGATCGAG GTGTGTCCTCCTTAAGTATTCAATTTGCCAAACTCCCAAAGGGATTGAAGCATTTGAACCTCTCTAAAACCT

CATTGTCACCTAAAG GGGTGAACAGCCTTTGTCAGTCCCTCAGTGCCAACCCTCTGACTGCCTCTACCCTCACCCACCTGGACCTCTCAGGGAATGCCC

TCCGCGGAGATGACCTCTCG CACATGTACAATTTTTTGGCCCAGCCCAACACCATTGTTCATCTGGATCTATCTAATACAGAATGTTCTCTGGAGATG 

GTGTGTAGCGCTCTCCTCCGGGGTTGCCTTCAGTGTCTCGCTGTGCTCAATCTCTCCAGATCTGTCTTCTCTCACAG GAAAGGAAAGGAAGTCCCTCCG

TCTTTCAAGCAGTTTTTCAGCAGTTCTCTGGCTTTGATCCAAATCAACCTTTCAGGCACGAAGCTGTCTCCCGAGCCCTTGAA AGCGCTGCTCTTGGGC

CTGGCCTGCAATCATAGCCTGAAGGGAGTCTCTCTGGATCTCAGCAACTGTGAG CTTGGCCACTGT CTGAGGTCAGGAGGAGCTCAAGTGTTAGAAGG

CTGCATCGCTGAAATCCACAACATCACCAGCTTAGATATCTCTGACAATG GTTTAGAATCCGACCTATCTACCCTAATTGTGTGGCTCAGTAAAAACAG

ATCAATACAGCACCTGGCATTGGGCAAAAATTTTAATAATATGAAATCCAA AAATCTGACGCCTGTGTTGGACAACTTAGTGCAGATGATCCAAGATGA

AGACTCT CCTCTGCAGTCGTTGTCCCTGGCTGACTCAAAACTCAAGGCTGAGGTCACCATCATCATCAATGCCCTGGGCAGCAACACCTCCCTGACCAA

AGTGGACATCAGTGGGAATGGCATGGGGGACATGGGAGCGAAGATGCTGGCCAAGGCTCTCCAGATCAACACCAAACTCAG GACAGTCATCTGGGACAA

AAACAACATCACTGCACAAGGCTTTCAAGACATAGCTGTTGCTATGGAAAA GAACTACACACTGCGATTTATGCCAATTCCGATGTATGATGCCGCTCA

AGCTCTCAAAACCAACCCCGAGAAAACAGAAGAGGCTCTGCAGAAG ATAGAAAATTATCTGCTCCGGAATCACGAGACCAGGAAATACCTTCAGGAGCA

GGCCTATCGCCTCCAGCAGGGCATCGTCACCAGCACCACCCAGCAG ATGATTGACCGGATATGTGTGAAGGTTCAGGATCACCTCAACTCCTTACGAGC

CTGTGGGGGTGATGCTATTCAGGAGGATTTAAAGGCAGCGGAGCGGCTCATGCGAGATGCTAAGAACTCTAAAACA TTGTTGCCCAATTTATATCATGT

GGGCGGTGCATCCTGGGCAGGAGCCAGTGGGCTGTCATCCAGTCCCATTCAGGAGACCCTGGAGTCGATGGCTGGAGAAGTCACAAGAGTGGTGGATGAA

CAACTGAAG GATTTGCTAGAATCCATGGTGGACGCAGCCGAGACCCTCTGCCCCAACGTCATGAGAAAAGCCCACATCCGACAGGACCTGATCCATGCC

AGCACCGAAAAGATTTCCATCCCACGTACCTTTGTTAAAAATGTCCTGTTGGAACAGTCCGGGATTGACATTCTTAACAAAATCAG TGAGGTGAAGCTG

ACAGTGGCCTCGTTCTTGTCTGACCGGATCGTCGATGAGATCCTGGATTCTCTCTCCAGCAGCCATCGGAAGCTG GCCAACCATTTCAGCAGGCTAAAC

AAGAGCCTTCCCCAGCGAGAGGACCTAGAGGTGGAGCTGGTGGAGGAGAAGCCGGTGAAACGGGCCATCCTCACGGTAGAGGATCTCACAGAGGTGGAGA

GGCTGGAAGACCTAGACACTTGTATG ATGACTCCTAAGTCCAAGAGGAAGAGCATCCACAGCCGAATGCTGCGGCCTGTCTCCAGGGCCTTCG AAATG

GAGTTTGATCTTGATAAAGCCCTGGAAGAGGTGCCGATTCACATCGAAGACCCACCTTTCCCATCAGTCCGGCAAGAGAAGCGAAGCTCGGGGTTAATCT

CTGAGCTGCCCTCGGAGGAAGGCAGGAGACTGGAACACTTCACCAAGTTAAGGCCCAAGCGGAACAAGAAGCAGCAACCTACGCAAGCAGCG GTCTGTA

CCATCAGCATCTTGCCCCAGGATGGAGAACAGAATGGCCTCATGGGCAGAGTGGATGAAGGGGTAGATGAGTTTTTCACCAAGAAGGTGACTAAAATGGA

TTGCAA GAGGTCATCCTCGCGCTCCTCAGATGCCCACGAACTCGGGGAAGGAGATGAGAAGAAAAAACGGGACTCTCGGAGGAGTGGCTTCCTCAACCT

GATTAAATCCAGGTCCAGATCTGAGCGGCCACCCACAGTCCTGATGACGGAAGAGCTCTCCTCCCCGAAAGGGGCAATGCGGAGCCCACCAGTGGATACC

ACCAGGAAGGAGATAAAGGCAGCGGAGCACAATGGTGCTCCAGACCGCACAGAAGAGATTAAGACACCGGAACCCCTGGAGGAGGGTCCAGCAGAGGAAG

CTGGCAGGGCTGAGCGCAGTGACAGCAGGGGCAGCCCGCAGGGTGGCCGGCGCTATGTGCAGGTGATGGGCAGCGGCCTGCTGGCCGAGATGAAGGCCAA

GCAGGAGCGGAGGGCAGCATGTGCACAGAAG - UNI28722 - AAGCTCGGCAATGATGTCATCTCCCAGGATCCTTCCAGCCCAGTCTCGTGCAACA

CAGAGCGTTTAGAAGGAGGGGCGACAG - UNI29258 - TGCCTAAACTGCAACCAGGTCTTCCAGAGGCCCGCTTTGGTTCGGGAACACCAGAAAAG

AATGCCAAAGCTGAACCCAGAGTGGATGGAGGCTGCAGGTCCCGGAGCTCCTCCAGCATGCCCACCAGCCCAAAGCCCCTCCTTCAGTCCCCTAAGCCCA

GCCCTTCAGCCCGGCCTTCTATCCCTCAGAAGCCAAGAACTGCCTCCCGACCTG - UNI29258 - AAGACACCCCAGACTCTCCATCTGGTCCTAGT

TCCCCTAAAGTTGCCCTCCTTCCACCCATCCTCAAAAAAGTCTCCTCGGACAAGGAGCGTGACGGCCAGAACAGCTCACAGTCCAGTCCTAGGAGCTTCT

CCCAGGAAG - UNI34726 - CCTCAAGGAGAAGCTGGGGCCCGGCCCAGGAGTATCAAGAACAGAAGCAACGGTCCTCGGGCAAAGATGGTCACCAA

GGGAGCAAATGCAGTGACTCTGGAGAAGAGGCAGAAAAAGAGTTTATTTTTGTGTAATGGTGCCCACCCCAAGCCTCTCCATGCAGGGCGCTCTCCTCAG

CTCTCAGAGAGGAGCCAGGGCCAGTACCTCTTCTCTCTTCTCTTGGTGCTTTCTTCTTTCTCTCCTTTCTTCTTTCTCATTTATATATATTTTCAAATTT

TTGGTCTTCCCCCATTCTTGGCATTTGATTTCTAAACACTGTTTCTTATGCCTTCAACAAAAAGCCAGCAATTATTCCATGGGCCCTACTTGAATTTCTC

TGAGGCAGCTACACATTGCCCTGCATGGTGAGTTGTTTTTGGAAATTAATGAAGTAACTGGACTCACACCCAAGTAACAATCCGGGAGGTCCTGGGGTGC

TACAGGGTGTGTTTGTGTCAGATCCACACATAACTCGATAGAGCAATTTATTCTTGATGTATGCAATTGCACATTGTAATTATATTAACAGAGCACACTA

ATAAATAATTTGTATAAATTATAAATATTAGATCTTGGGCACAGTTCTTACATTCTTTTGTGGGACATTTCCTTCCCCATGTAGAATTGTACATTTAAAC

CTTGGTTGGTAATATTTGCAGACCATCGGCAAGCACAGCTAAAAACAGTGTGAGAAGCTCAGATTCATGTATATACTTGATTGGAATGAGGTCTTATAAA

TATTCATGTTTCTGAAGGCCTTTAA
Translation
MTDESSDVPRELME ESIKDVIGRKIKISVKKKVKLEVKGDRVENKVL - UNI4295 - - UNI4536 - VLTSCRAFLLSARIPSK - UNI4536

 - LELTFSYLEIHGVICHKPAQ - UNI3853 - MVVETEKCNMSMKMVSPEDVSEVLAHIGTCLRRIFPGLSPL LRIMKKVSMEPSERLASLQALW

DSQTLAEPGPCG GGFSQMYACVCDWLGFSYKEEVQW DVDTIYLTQDTRELNLQDFSHLEHR RDLIPIIAALEYNQWFTKLSSKDLKL STDVCEQIL

RVVSRSNRLEELVLENAGLRI IDFAQKLAGALAHNPNSGLHTINLAGNSLEDRG GVSSLSIQFAKLPKGLKHLNLSKTSLSPKG GVNSLCQSLSANP

LTASTLTHLDLSGNALRGDDLS HMYNFLAQPNTIVHLDLSNTECSLEM VCSALLRGCLQCLAVLNLSRSVFSHR RKGKEVPPSFKQFFSSSLALIQI

NLSGTKLSPEPLK KALLLGLACNHSLKGVSLDLSNCE LGHC LRSGGAQVLEGCIAEIHNITSLDISDNG GLESDLSTLIVWLSKNRSIQHLALGKN

FNNMKSK KNLTPVLDNLVQMIQDEDS PLQSLSLADSKLKAEVTIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTKLR RTVIWDKNNITAQ

GFQDIAVAMEK KNYTLRFMPIPMYDAAQALKTNPEKTEEALQK IENYLLRNHETRKYLQEQAYRLQQGIVTSTTQQ MIDRICVKVQDHLNSLRACGG

DAIQEDLKAAERLMRDAKNSKT LLPNLYHVGGASWAGASGLSSSPIQETLESMAGEVTRVVDEQLK DLLESMVDAAETLCPNVMRKAHIRQDLIHAST

EKISIPRTFVKNVLLEQSGIDILNKIS SEVKLTVASFLSDRIVDEILDSLSSSHRKL ANHFSRLNKSLPQREDLEVELVEEKPVKRAILTVEDLTEVE

RLEDLDTCM MTPKSKRKSIHSRMLRPVSRAFE EMEFDLDKALEEVPIHIEDPPFPSVRQEKRSSGLISELPSEEGRRLEHFTKLRPKRNKKQQPTQAA

 VCTISILPQDGEQNGLMGRVDEGVDEFFTKKVTKMDCK KRSSSRSSDAHELGEGDEKKKRDSRRSGFLNLIKSRSRSERPPTVLMTEELSSPKGAMRS

PPVDTTRKEIKAAEHNGAPDRTEEIKTPEPLEEGPAEEAGRAERSDSRGSPQGGRRYVQVMGSGLLAEMKAKQERRAACAQK - UNI28722 - KLGN

DVISQDPSSPVSCNTERLEGGATV - UNI29258 - VPKLQPGLPEARFGSGTPEKNAKAEPRVDGGCRSRSSSSMPTSPKPLLQSPKPSPSARPSIP

QKPRTASRPE - UNI29258 - EDTPDSPSGPSSPKVALLPPILKKVSSDKERDGQNSSQSSPRSFSQEA - UNI34726 - ASRRSWGPAQEYQE

QKQRSSGKDGHQGSKCSDSGEEAEKEFIFV

For any suggestions or comments, please send an email to unitrap@crg.es