Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021357 (Exoc2)
Chromosomal location
Chr 13: 30905788 - 31065916 (-)
exocyst complex component 2 Gene [Source:MGI (curated);Acc:Exoc2-001]
Q5SUZ6 Q8C984 Q8K2J3 
Human Ortholog
ENSG00000112685 (EXOC2)
Omim not available
UniTrap UNI30166
Vector Insertion
Chr 13: 31042048 - 31065917
Public Clones 5SE284F01 (ggtc) D095D04 (ggtc) 3SE284F01 (ggtc) IST14587G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25241
Vector Insertion
Chr 13: 31038293 - 31042048
Public Clones not available
Private Clones OST190594 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25539
Vector Insertion
Chr 13: 31032478 - 31032640
Public Clones not available
Private Clones OST178354 (lexicon) OST118785 (lexicon) OST93351 (lexicon) OST68626 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29479
Vector Insertion
Chr 13: 31032478 - 31038293
Public Clones P142G01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29822
Vector Insertion
Chr 13: 31029984 - 31032640
Public Clones E057G11 (ggtc) IST13035G11 (tigm) IST14961A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5072
Vector Insertion
Chr 13: 30998454 - 30998600
Public Clones YTC559 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8807
Vector Insertion
Chr 13: 30978184 - 30992653
Public Clones TEA063 (baygenomics) A001G07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8291
Vector Insertion
Chr 13: 30948665 - 30956699
Public Clones RRF255 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12205
Vector Insertion
Chr 13: 30917964 - 30948522
Public Clones A045C05 (ggtc) A053E02 (ggtc) A026F07 (ggtc) A049E08 (ggtc) IST13832A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102946













































 - UNI25241 - - UNI29479 - - UNI30166 -  - UNI25539 - - UNI29479 - - UNI29822 - MSRSRQPPLVTGISPNEGIP











Transcript ENSMUST00000021785












































 - UNI25241 - - UNI25539 - - UNI29479 - - UNI29822 - - UNI30166 - MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTG












For any suggestions or comments, please send an email to