Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021360 (Gcnt2)
Chromosomal location
Chr 13: 40955501 - 41056260 (+)
Description
glucosaminyl (N-acetyl) transferase 2, I-branching enzyme Gene [Source:MGI Symbol;Acc:MGI:1100870]
RefSeq_dna
NM_133219 NM_008105 NM_023887 
RefSeq_peptide
NP_573482.1 NP_032131.2 NP_076376.3 
UniGene
Mm.470743 Mm.314757 
MGI
MGI:1100870 
Uniprot/SWISSPROT
P97402 
Uniprot/SPTREMBL
Q3TFF2 Q3UJ01 Q7TPQ8 Q9D2A8 A2IQH5 Q6T5E3 Q8BW63 A2IQH4 Q6T5E4 Q8BK09 
Human Ortholog
ENSG00000111846 (GCNT2)
Omim 110800 - BLOOD GROUP--I SYSTEM; Ii  
UniTrap UNI30239
Vector Insertion
Chr 13: 40956643 - 40982534
Public Clones (sanger) D067E06 (ggtc) IST11225H4 (tigm) IST13862H2 (tigm) IST12134B1 (tigm)
IST13650D9 (tigm) IST13096C5 (tigm) IST13912H11 (tigm) IST14653C8 (tigm)
IST11523E3 (tigm) IST13119D9 (tigm) IST10671B12 (tigm) IST14405B12 (tigm)
IST14033E8 (tigm) IST13970F5 (tigm) IST12388E5 (tigm) IST12130F8 (tigm)
IST11041E6 (tigm) IST13828F9 (tigm) IST12390F5 (tigm) IST12604C12 (tigm)
IST12131H11 (tigm) IST12657A10 (tigm) IST12348F8 (tigm) IST11547H8 (tigm)
IST12572C10 (tigm) IST13929H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11477
Vector Insertion
Chr 13: 40983659 - 40984563
Public Clones M117C08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30903
Vector Insertion
Chr 13: 40984580 - 41013002
Public Clones (ggtc) IST12773B11 (tigm) IST12324A7 (tigm) IST12326B6 (tigm) IST14812C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15894
Vector Insertion
Chr 13: 41014171 - 41048944
Public Clones PST24373-NR (escells) IST14256C4 (tigm)
Private Clones OST470859 (lexicon) OST469998 (lexicon) OST467906 (lexicon) OST464949 (lexicon)
OST464250 (lexicon) OST433812 (lexicon) OST411036 (lexicon) OST405978 (lexicon)
OST379093 (lexicon) OST367806 (lexicon) OST360968 (lexicon) OST360804 (lexicon)
OST357940 (lexicon) OST346807 (lexicon) OST326112 (lexicon) OST180688 (lexicon)
OST169399 (lexicon) OST169270 (lexicon) OST152753 (lexicon) OST149663 (lexicon)
OST147625 (lexicon) OST131216 (lexicon) OST97817 (lexicon) OST97613 (lexicon)
OST64770 (lexicon) OST59817 (lexicon) OST37918 (lexicon)
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12910
Vector Insertion
Chr 13: 41049041 - 41053520
Public Clones CMHD-GT_353B5-3 (cmhd) PST23231-NR (escells)
Private Clones OST456509 (lexicon) OST449373 (lexicon) OST405487 (lexicon) OST367756 (lexicon)
OST312261 (lexicon) OST300926 (lexicon) OST235901 (lexicon) OST206340 (lexicon)
OST200071 (lexicon) OST179576 (lexicon) OST147316 (lexicon) OST126256 (lexicon)
OST106278 (lexicon) OST100717 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067778
Sequence
AGGAGATTCAAGCTTCAGATGCGAAGTGCGGTGGGAAAGCTGCTAAACTCCAGCCAGTCCCGGAGGATGGGCCAGACTCCCACGCACTGGAGACCCACGC

CTTGAGAGCTGGGGAGCGTGAGCCCGCATCTGTGCGGGAGAAGCCGGCGAATCTGGAGGAGCCAGATCCACCTCTAGCGCCTGGGCTTTCAGAACTGTGG

TCACTTCTCAGTCTCCAGTGATAATTCTTCCCGCCTGGAACCCTAAATAATGAGCCTACGCGGGAAAGTTTTCGCTGTCTCTGCGCTCAGCGTGGTGATT

TTTGTGGTTTTTTATCACAGCCAGCTAAGCCTGCCCAACCTCTACCAGCAGCTCAACAGCTCCAGCGAAAGGACGTCTGTCACCATCTGTGATTACGGCT

TGCAAAATCATACGTTCTTCACGACGGGGGACACATCACCACATCCTTTAGAAAGACTCTCCTGTCCTCAATACCGGATCCAGAGCCACTATATTACCAG

TCCCCTTTCGGAAGAAGAGGCTGCCTTTCCCCTGGCTTACATCATGGTGATCCACAAAGACTTCGATACCTTTGAAAGGCTCTTCAGGGCCATTTACATG

CCCCAGAACGTCTACTGTGTGCATGTGGATAGTAAGGCGACAGACACCTTCAAAGAAGCGGTGCGGCAGTTACTAAGCTGTTTCCCCAATGCCTTCCTGG

CCTCTAAGGTGGAGCAGGTGGTCTATGGTGGCTTCTCTCGGCTCCAGGCTGATCTGAACTGCATGAAAGATCTGGTGGCCTCCAAGGTCCCCTGGAAATA

TGTCCTCAACACCTGCGGGCAGGACTTCCCTTTGAAAACCAACAAGGAAATAATTAACCATCTGAAAAGATTTAAGGGGAAAAACATCACTCCGGGAGTG

CTGCCCCCTGCGTACATAGTTGTACGGACTAAATATGTACACCAGGAACGCAAAGGCAAAGACGGATATTTTATGCATAAAACAAATATTTTGAAGACTC

CACCTCCACACCAACTGATCATCTACTTCGGCACAGCCTACGTGGCCCTCACCCGGGACTTTGTCAACTTTATCCTGAATGACGAAAGGGCCATTGCTCT

CTTAGAGTGGTCTAAAGATACCTATAGCCCTGATGAACATTTTTGGGTGACACTCAATAGGATTCCAG - UNI15894 - GAGTCCCTGGCTCCATGC

CACCAAACGCATCCTGGACGGGTAACCTCAGAGCTGTGAAGTGGATGGACATGGAAGCGAAGCATGGAGGCTGCCATG - UNI12910 - GTCACTAC

GTCCATGGCATTTGTATCTATGGAAACGGAGACTTGCAGTGGCTGATTAATTCGCAAAGCCTGTTTGCTAACAAATTTGAACTCAACACATACCCTCTTA

CCGTGGAATGCCTGGAACTGAGGCTTCGAGAAAGAACACTCAACCAGAGTGAGATCGCCATACAGCCGAGCTGGTATTTCTGACCCGCAGCAGCTCGGGC

CTAAATGGAAATTGAAGACGTAAAGAAGAGCTTTCTTTTCCAAGAGACTCTGGTCTTGGCTATGCTGAAGACTTTTTTAAAAAATGGTTTTCAGGGAACC

GTGAGGATCTGGCAACATGGCTCTGCTTGCAATATCCACTGAGCACTGTAATACATTTGACAGGATGGCTGCATGAAACTGTCCAGCATTTTTCTGTCGT

TTCCCCCCCACCCCAAATCCTTTTTTTCTCTTCTTTTTTAAAAGATAGGTAGGGTCTTGCTAGATATCTCTAGCAAGCCTGTTTCTTGTCAGGTAGCCCA

GGATGGCCTTGAACTCTTAATCCTCCGCCTTGGCCCTCTAAGGGCTGCTAGTCCGAGTGTGGACAACCACACCTGGCTCTGGCGTCTGGCGGTCACTTGA

CGCTCATCTGCGTCTCCGTCTGCTAGGTGGTCGGTGATAAATTCAAATGTATCAGATCTCTGTGCCAGATACTCATATTAGTATACCCTGTTCAAAGGAG

AATGGTGGATAATACTGTCTGAGGAAATCAGAACTTATTTGAGAAGGAAGCTCTCGTTCCACATTCCTAGCAACTATATTCTCAGGCACACATAGGCGCA

CAGAGACAGCTTCCTAGTAACTCACATCAATTTCGTTTAATACAAACTGATCCTGAAGAGCTGAGGAACTATGTAAGTTCAGTGTCCAAGCATTTGACTG

ACATTTGTGCAGAGTTAGGTTCCATCTCCAGCATCACGCACGGGTCTTGTGAACACCGACATCTTCAGTTTACTTGTGTCTGCAGTTCTGTGGACAGAAC

AAAGCCATTCACAAGTGACCGACAGCACGTGCCGTGAGACGGGAGGTGGCTGCAGGAAGAGGATGCCTCAGGGATGCCGGACATTTCCGTGTTCTATTCC

AGAGTGTTCTCTTCTCCCAGAGAACACTGGAACGTCCTCACAGGGATGAAGGAATTCTTTCTTTCCCACAGGAAAGGTGCTACTGTGTGGGTCTGGAACC

TGTGAATGAATCACTCCTGGGGTTTCGTTTCTATGTGAGAGACGGGGACCCGGTTCTGTTGTGTGCAGCTTTAGCGGCATCAGGACAGCTTCCAGCTTGC

AATGATTGCTGCTGACAGGAACACCTGGATCTCAAGAGCTTTTTATGACAGGTGGACATCTGTGTCATTTTTCCTTGTTCCCTCATCCATCCATCCATCC

ATCCATCCATCCATCCATCCATCCATCCATTCGTCAGCCTACATTCAACAAACGCCTCTTGAATGTCTATGATTCCCCCAGACACATGCTGACAGACACG

AGGGAAGCAAGACAGATTCTTTCTCCACTGTTAAACTCTGGGGAGTGGTATCAGCTTTTGAAACCCTGCTCTAGACTCTTACAAAATGGCTACACTTAGC

ACATACTCTGCCCTGGCTATATATTATATTGGGCCATAGAGATCAGCAATGTATCAATTAATAGATTAATCCAGAGACAGGAAGGAGGAAACGAAAGCTA

GAGCCTCTTTGTGACTCCACCAACTCCTTCTTGTCTCCTTTTATTGAAGAGTCCGCACACATACTCACCCCTCTGGTGGGCCACATGAGGACCTGCATCT

TGCAGATGATGTAGCAAGCCTTAGGATGGTTCATGATCAGTAGGAAGCAAATTCTAAGACCTCAGGGTGTCTTTCTGAGTCTCTCATTTCTTTAGGGATG

TGGAGAGAAGATGAAGTATAGCCGTGTGTAGTGTCGCCAGAGAAGGTGGAGTTTAAGAATGGTCTCAGTGTTATTAATGAGAAAAAGTTCTGTCATTCAG

GAAAAAAAAGCAAAAAACGTGAGGTTGGGACTCAGTAGGTGAGGGTGCTTGCAGCCAAACCTGATGACCTGCATTCAATTCCTGGGTCCCACGGGACAGA

GGGAGAGAGTCCACTACTGAAAGGAACGCTCAAACCTCCTCACACAGGTCCTTGTGCCTGGGCACTCCCCCGCCCCATATGCATACACACATACATGCTT

TTGTGATTTTTTTTATTAGTGCTTTTACATTTAGAAATATTTATTTATTCTAGCAGGGAAAAAACCCCACATGCTTTAAATGATGTCACTTTCCACAACT

TCATTCTTGTGCTGTCATTGGACTGAATGTTATGCATCTTTAAAGGGAATCACTTCGTGTAAAACTCTCTTGTCTCTTCTGCTGAAAAGTAAAATGGGTT

GTGTCGGGTAATAAAGGGTCGAGGGGTAGGAAGCACTTGGTCAAGGCGAAGTCTAAAACCGGTCTCTTTTTTATTTGTTACTTGGATGAGAGCACCTGAA

GACTAATGTTTTACACTGGATTGAGATCTCATGGAAAATGAAACATTCTTTTTCTGGAGAAGTTTACATGCCCATTGTTGGTCACCTCTTTACTGTAAAT

ACTATTGAAAAAAGGAGCGTAGCATTTGCATAGCAGGGATTGTGCCTGTATCTACTGTGTCCATTTTGTTTTTTCGGATGTTTTCTGGTTTTGTTTCCTT

GGAAATAAATTAATATATTGTTTTCCACCTTC
Translation
MSLRGKVFAVSALSVVIFVVFYHSQLSLPNLYQQLNSSSERTSVTICDYGLQNHTFFTTGDTSPHPLERLSCPQYRIQSHYITSPLSEEEAAFPLAYIMV

IHKDFDTFERLFRAIYMPQNVYCVHVDSKATDTFKEAVRQLLSCFPNAFLASKVEQVVYGGFSRLQADLNCMKDLVASKVPWKYVLNTCGQDFPLKTNKE

IINHLKRFKGKNITPGVLPPAYIVVRTKYVHQERKGKDGYFMHKTNILKTPPPHQLIIYFGTAYVALTRDFVNFILNDERAIALLEWSKDTYSPDEHFWV

TLNRIPG - UNI15894 - GVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHG - UNI12910 - GHYVHGICIYGNGDLQWLINSQSLFANKFELN

TYPLTVECLELRLRERTLNQSEIAIQPSWYF
Transcript ENSMUST00000110190
Sequence
ATGCCTCCGTCCGTGCGTTACTTCTTCATAGTGTCTGTGACTACTGTCATCGTTTTTATTGTGCTCTACGTGTTAAGTTTTGGAGGAGATCAAAGCTACC

AGAAGCTGAACATCTCAGACTCGGTGATGCTGGCTCAAGTGTGCTCATCTTTCATCGACGGGAAAAGCCGGTTCCTGTGGAGAAACAAACTAATGATTCA

CGAGAAGCCTTCTTGCACAGAATATGTGACCCAAAGCCACTATATCACTGCCCCTTTATCTCAGGAAGAGGTCGATTTTCCTTTGGCGTATGTCATGGTC

ATCCATCACAATTTTGACACCTTTGCAAGGCTCTTCAGGGCAATCTTCATGCCTCAAAATATCTACTGTGTTCACGTGGATGAAAAGGCAACAGCTGAAT

TCAAAGGTGCCGTGGAACAGTTAGTGAGCTGCTTCCCCAATGCCTTTCTGGCTTCTAAGATGGAGCCGGTGGTCTATGGTGGAATCTCCCGGCTCCAGGC

TGACCTGAACTGCATCAAAGACCTGTCCACCTCCGAGGTCCCCTGGAAGTACGCCATCAACACCTGTGGACAAGACTTCCCCCTGAAAACCAACAAGGAG

ATAGTTCAGTACCTGAAAGGGCTTAAGGGGAAGAACCTCACTCCCGGGGTGCTGCCTCCAGCCCACGCCATTGGAAGGACCAGGTACGTCCACCGGGAAC

ACCTAAGCAAAGAGCTTTCCTACGTGATCAGAACCACGGCTCTGAAGCCCCCACCTCCCCACAACCTCACCATTTATTTTGGCTCTGCCTATGTCGCCCT

GTCGAGAGAGTTTGCTAACTTTGTTCTCCGTGACCCACGGGCGGTTGATTTGCTCCATTGGTCCAAAGATACTTTCAGTCCCGATGAGCATTTCTGGGTG

ACGCTCAATAGGATTCCAGGTAT - UNI11477 - CCCAGGTTCCCCACCC
Translation
MPPSVRYFFIVSVTTVIVFIVLYVLSFGGDQSYQKLNISDSVMLAQVCSSFIDGKSRFLWRNKLMIHEKPSCTEYVTQSHYITAPLSQEEVDFPLAYVMV

IHHNFDTFARLFRAIFMPQNIYCVHVDEKATAEFKGAVEQLVSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKE

IVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLSKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLRDPRAVDLLHWSKDTFSPDEHFWV

TLNRIPGI - UNI11477 - IPGSPP
Transcript ENSMUST00000069958
Sequence
CAAAGGAGGTTTGAGAGAGGCGGGATCAGATTCTAATATCTGCTCCAGGAGAGAGCTCGCTGCTGGGCTCCGGGAGACAAAACAGCCGCAATTCACACTG

ACTGGAGCATGTACCACAGCGAGAGCTCCCAGGAAAAAGTAAGTCCGAGAAGGGATTGGCCAAGCTTGACGGACTCTGACATCGGAGACCCTCTTTGAGG

CATGCCTCCGTCCGTGCGTTACTTCTTCATAGTGTCTGTGACTACTGTCATCGTTTTTATTGTGCTCTACGTGTTAAGTTTTGGAGGAGATCAAAGCTAC

CAGAAGCTGAACATCTCAGACTCGGTGATGCTGGCTCAAGTGTGCTCATCTTTCATCGACGGGAAAAGCCGGTTCCTGTGGAGAAACAAACTAATGATTC

ACGAGAAGCCTTCTTGCACAGAATATGTGACCCAAAGCCACTATATCACTGCCCCTTTATCTCAGGAAGAGGTCGATTTTCCTTTGGCGTATGTCATGGT

CATCCATCACAATTTTGACACCTTTGCAAGGCTCTTCAGGGCAATCTTCATGCCTCAAAATATCTACTGTGTTCACGTGGATGAAAAGGCAACAGCTGAA

TTCAAAGGTGCCGTGGAACAGTTAGTGAGCTGCTTCCCCAATGCCTTTCTGGCTTCTAAGATGGAGCCGGTGGTCTATGGTGGAATCTCCCGGCTCCAGG

CTGACCTGAACTGCATCAAAGACCTGTCCACCTCCGAGGTCCCCTGGAAGTACGCCATCAACACCTGTGGACAAGACTTCCCCCTGAAAACCAACAAGGA

GATAGTTCAGTACCTGAAAGGGCTTAAGGGGAAGAACCTCACTCCCGGGGTGCTGCCTCCAGCCCACGCCATTGGAAGGACCAGGTACGTCCACCGGGAA

CACCTAAGCAAAGAGCTTTCCTACGTGATCAGAACCACGGCTCTGAAGCCCCCACCTCCCCACAACCTCACCATTTATTTTGGCTCTGCCTATGTCGCCC

TGTCGAGAGAGTTTGCTAACTTTGTTCTCCGTGACCCACGGGCGGTTGATTTGCTCCATTGGTCCAAAGATACTTTCAGTCCCGATGAGCATTTCTGGGT

GACGCTCAATAGGATTCCAG - UNI11477 - - UNI15894 - - UNI30903 - GAGTCCCTGGCTCCATGCCACCAAACGCATCCTGGACGGG

TAACCTCAGAGCTGTGAAGTGGATGGACATGGAAGCGAAGCATGGAGGCTGCCATG - UNI12910 - GTCACTACGTCCATGGCATTTGTATCTATG

GAAACGGAGACTTGCAGTGGCTGATTAATTCGCAAAGCCTGTTTGCTAACAAATTTGAACTCAACACATACCCTCTTACCGTGGAATGCCTGGAACTGAG

GCTTCGAGAAAGAACACTCAACCAGAGTGAGATCGCCATACAGCCGAGCTGGTATTTCTGACCCGCAGCAGCTCGGGCCTAAATGGAAATTGAAGACGTA

AAGAAGAGCTTTCTTTTCCAAGAGACTCTGGTCTTGGCTATGCTGAAGACTTTTTTAAAAAATGGTTTTCAGGGAACCGTGAGGATCTGGCAACATGGCT

CTGCTTGCAATATCCACTGAGCACTGTAATACATTTGACAGGATGGCTGCATGAAACTGTCCAGCATTTTTCTGTCGTTTCCCCCCCACCCCAAATCCTT

TTTTTCTCTTCTTTTTTAAAAGATAGGTAGGGTCTTGCTAGATATCTCTAGCAAGCCTGTTTCTTGTCAGGTAGCCCAGGATGGCCTTGAACTCTTAATC

CTCCGCCTTGGCCCTCTAAGGGCTGCTAGTCCGAGTGTGGACAACCACACCTGGCTCTGGCGTCTGGCGGTCACTTGACGCTCATCTGCGTCTCCGTCTG

CTAGGTGGTCGGTGATAAATTCAAATGTATCAGATCTCTGTGCCAGATACTCATATTAGTATACCCTGTTCAAAGGAGAATGGTGGATAATACTGTCTGA

GGAAATCAGAACTTATTTGAGAAGGAAGCTCTCGTTCCACATTCCTAGCAACTATATTCTCAGGCACACATAGGCGCACAGAGACAGCTTCCTAGTAACT

CACATCAATTTCGTTTAATACAAACTGATCCTGAAGAGCTGAGGAACTATGTAAGTTCAGTGTCCAAGCATTTGACTGACATTTGTGCAGAGTTAGGTTC

CATCTCCAGCATCACGCACGGGTCTTGTGAACACCGACATCTTCAGTTTACTTGTGTCTGCAGTTCTGTGGACAGAACAAAGCCATTCACAAGTGACCGA

CAGCACGTGCCGTGAGACGGGAGGTGGCTGCAGGAAGAGGATGCCTCAGGGATGCCGGACATTTCCGTGTTCTATTCCAGAGTGTTCTCTTCTCCCAGAG

AACACTGGAACGTCCTCACAGGGATGAAGGAATTCTTTCTTTCCCACAGGAAAGGTGCTACTGTGTGGGTCTGGAACCTGTGAATGAATCACTCCTGGGG

TTTCGTTTCTATGTGAGAGACGGGGACCCGGTTCTGTTGTGTGCAGCTTTAGCGGCATCAGGACAGCTTCCAGCTTGCAATGATTGCTGCTGACAGGAAC

ACCTGGATCTCAAGAGCTTTTTATGACAGGTGGACATCTGTGTCATTTTTCCTTGTTCCCTCATCCATCCATCCATCCATCCATCCATCCATCCATCCAT

CCATCCATTCGTCAGCCTACATTCAACAAACGCCTCTTGAATGTCTATGATTCCCCCAGACACATGCTGACAGACACGAGGGAAGCAAGACAGATTCTTT

CTCCACTGTTAAACTCTGGGGAGTGGTATCAGCTTTTGAAACCCTGCTCTAGACTCTTACAAAATGGCTACACTTAGCACATACTCTGCCCTGGCTATAT

ATTATATTGGGCCATAGAGATCAGCAATGTATCAATTAATAGATTAATCCAGAGACAGGAAGGAGGAAACGAAAGCTAGAGCCTCTTTGTGACTCCACCA

ACTCCTTCTTGTCTCCTTTTATTGAAGAGTCCGCACACATACTCACCCCTCTGGTGGGCCACATGAGGACCTGCATCTTGCAGATGATGTAGCAAGCCTT

AGGATGGTTCATGATCAGTAGGAAGCAAATTCTAAGACCTCAGGGTGTCTTTCTGAGTCTCTCATTTCTTTAGGGATGTGGAGAGAAGATGAAGTATAGC

CGTGTGTAGTGTCGCCAGAGAAGGTGGAGTTTAAGAATGGTCTCAGTGTTATTAATGAGAAAAAGTTCTGTCATTCAGGAAAAAAAAGCAAAAAACGTGA

GGTTGGGACTCAGTAGGTGAGGGTGCTTGCAGCCAAACCTGATGACCTGCATTCAATTCCTGGGTCCCACGGGACAGAGGGAGAGAGTCCACTACTGAAA

GGAACGCTCAAACCTCCTCACACAGGTCCTTGTGCCTGGGCACTCCCCCGCCCCATATGCATACACACATACATGCTTTTGTGATTTTTTTTATTAGTGC

TTTTACATTTAGAAATATTTATTTATTCTAGCAGGGAAAAAACCCCACATGCTTTAAATGATGTCACTTTCCACAACTTCATTCTTGTGCTGTCATTGGA

CTGAATGTTATGCATCTTTAAAGGGAATCACTTCGTGTAAAACTCTCTTGTCTCTTCTGCTGAAAAGTAAAATGGGTTGTGTCGGGTAATAAAGGGTCGA

GGGGTAGGAAGCACTTGGTCAAGGCGAAGTCTAAAACCGGTCTCTTTTTTATTTGTTACTTGGATGAGAGCACCTGAAGACTAATGTTTTACACTGGATT

GAGATCTCATGGAAAATGAAACATTCTTTTTCTGGAGAAGTTTACATGCCCATTGTTGGTCACCTCTTTACTGTAAATACTATTGAAAAAAGGAGCGTAG

CATTTGCATAGCAGGGATTGTGCCTGTATCTACTGTGTCCATTTTGTTTTTTCGGATGTTTTCTGGTTTTGTTTCCTTGGAAATAAATTAATATATTGTT

TTCCACCTTC
Translation
MPPSVRYFFIVSVTTVIVFIVLYVLSFGGDQSYQKLNISDSVMLAQVCSSFIDGKSRFLWRNKLMIHEKPSCTEYVTQSHYITAPLSQEEVDFPLAYVMV

IHHNFDTFARLFRAIFMPQNIYCVHVDEKATAEFKGAVEQLVSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKE

IVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLSKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLRDPRAVDLLHWSKDTFSPDEHFWV

TLNRIPG - UNI11477 - - UNI15894 - - UNI30903 - GVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHG - UNI12910 - GHYVHG

ICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF
Transcript ENSMUST00000110191
Sequence
CTGCTTCGGAAGTCTGTCAATGAAAAAAAGGAAACAGAAACAAGCTAAGAAAAGGGAAGGGAGAGAAGAACGAGCCAAGGAGCTTTGCTCATCAGAGCCT

CATCCGTGCGGGATGGTACATCCGTGCGGGATGATACTGGGACCTGGGGAAAACGTAAGTTAAAGGAAGCTTTGCTCCAATTCTGTCTCTGAAGACACTT

GGCTCATTTCCTGCTTTGGGAAGATGGGCTCTTGGAAGTACAGTCTTTTCAGCCTATCTCTCATTGCTGCCTTGATGCTTATGTTTATGTACGATAGAAA

ATTATGGAAGAACTATCATTTCCCGAGGGCGGTTTCCAATATTTCAGTCTTAGCGGAAGTCTGCTTGCAGATGTTCAGTGGGGAGAGTTTTTATACAGCG

GACAGCGCACGGAAAACCACCCTGGAAAACTTCACCTGCCCCGAGTACAAGATTCAAAACCACTACATAACAGAGACTCTCTCTGAAGAAGAAGCCCGCT

TCCCTCTGGCTTTCACACTTACTATCCACAAAGATTATGACACTTTCGAGAGACTCTTCAGGGCCATTTACATGCCCCAGAACGTCTACTGTGTGCACGT

GGATAGTAAGGCGACAGACACCTTCAAAGAAGAGGTGCGGCAGTTACTAAGCTGTTTCCCCAATGCCTTCCTGGCCTCTAGGATGGAGCCGGTGGTCTAT

GGTGGCTTCTCCCGGCTCCAAGCTGATCTGAACTGCATGAAAGATCTGGTGGCCTCCAAGATCCCCTGGAAATATGTCCTCAACACCTGCGGGCAGGACT

TTCCTCTGAAAACCAACAAAGAAATAGTTCAGTACCTGAAACGGTTTATTGGGAAGAACCTCACCCCAGGGGTGCTGCCTCCTGCACATGCAGTTGGAAG

AACCAAGTACGTCCACCAGGAGCTGTTAGACCATAAAAATCCCTACGTGCACAATACAGCAAGATTAAAAGCTCCCCCACCTCACAACCTGACCATTTAC

TTTGGCACTGCTTATGTGGCTCTCACACGGGAATTTGCTAACTTTGTCCTCAAAGACCAGCGTTCAGTAGACTTAATCTCCTGGTCCAAGGACACGTATA

GTCCTGATGAGCACTTCTGGGTGACACTCAATAGGATCCCTG - UNI11477 - - UNI15894 - - UNI30239 - - UNI30903 - GAGTC

CCTGGCTCCATGCCACCAAACGCATCCTGGACGGGTAACCTCAGAGCTGTGAAGTGGATGGACATGGAAGCGAAGCATGGAGGCTGCCATG - UNI129

10 - GTCACTACGTCCATGGCATTTGTATCTATGGAAACGGAGACTTGCAGTGGCTGATTAATTCGCAAAGCCTGTTTGCTAACAAATTTGAACTCAAC

ACATACCCTCTTACCGTGGAATGCCTGGAACTGAGGCTTCGAGAAAGAACACTCAACCAGAGTGAGATCGCCATACAGCCGAGCTGGTATTTCTGACCCG

CAGCAGCTCGGGCCTAAATGGAAATTGAAGACGTAAAGAAGAGCTTTCTTTTCCAAGAGACTCTGGTCTTGGCTATGCTGAAGACTTTTTTAAAAAATGG

TTTTCAGGGAACCGTGAGGATCTGGCAACATGGCTCTGCTTGCAATATCCACTGAGCACTGTAATACATTTGACAGGATGGCTGCATGAAACTGTCCAGC

ATTTTTCTGTCGTTTCCCCCCCACCCCAAATCCTTTTTTTCTCTTCTTTTTTAAAAGATAGGTAGGGTCTTGCTAGATATCTCTAGCAAGCCTGTTTCTT

GTCAGGTAGCCCAGGATGGCCTTGAACTCTTAATCCTCCGCCTTGGCCCTCTAAGGGCTGCTAGTCCGAGTGTGGACAACCACACCTGGCTCTGGCGTCT

GGCGGTCACTTGACGCTCATCTGCGTCTCCGTCTGCTAGGTGGTCGGTGATAAATTCAAATGTATCAGATCTCTGTGCCAGATACTCATATTAGTATACC

CTGTTCAAAGGAGAATGGTGGATAATACTGTCTGAGGAAATCAGAACTTATTTGAGAAGGAAGCTCTCGTTCCACATTCCTAGCAACTATATTCTCAGGC

ACACATAGGCGCACAGAGACAGCTTCCTAGTAACTCACATCAATTTCGTTTAATACAAACTGATCCTGAAGAGCTGAGGAACTATGTAAGTTCAGTGTCC

AAGCATTTGACTGACATTTGTGCAGAGTTAGGTTCCATCTCCAGCATCACGCACGGGTCTTGTGAACACCGACATCTTCAGTTTACTTGTGTCTGCAGTT

CTGTGGACAGAACAAAGCCATTCACAAGTGACCGACAGCACGTGCCGTGAGACGGGAGGTGGCTGCAGGAAGAGGATGCCTCAGGGATGCCGGACATTTC

CGTGTTCTATTCCAGAGTGTTCTCTTCTCCCAGAGAACACTGGAACGTCCTCACAGGGATGAAGGAATTCTTTCTTTCCCACAGGAAAGGTGCTACTGTG

TGGGTCTGGAACCTGTGAATGAATCACTCCTGGGGTTTCGTTTCTATGTGAGAGACGGGGACCCGGTTCTGTTGTGTGCAGCTTTAGCGGCATCAGGACA

GCTTCCAGCTTGCAATGATTGCTGCTGACAGGAACACCTGGATCTCAAGAGCTTTTTATGACAGGTGGACATCTGTGTCATTTTTCCTTGTTCCCTCATC

CATCCATCCATCCATCCATCCATCCATCCATCCATCCATCCATTCGTCAGCCTACATTCAACAAACGCCTCTTGAATGTCTATGATTCCCCCAGACACAT

GCTGACAGACACGAGGGAAGCAAGACAGATTCTTTCTCCACTGTTAAACTCTGGGGAGTGGTATCAGCTTTTGAAACCCTGCTCTAGACTCTTACAAAAT

GGCTACACTTAGCACATACTCTGCCCTGGCTATATATTATATTGGGCCATAGAGATCAGCAATGTATCAATTAATAGATTAATCCAGAGACAGGAAGGAG

GAAACGAAAGCTAGAGCCTCTTTGTGACTCCACCAACTCCTTCTTGTCTCCTTTTATTGAAGAGTCCGCACACATACTCACCCCTCTGGTGGGCCACATG

AGGACCTGCATCTTGCAGATGATGTAGCAAGCCTTAGGATGGTTCATGATCAGTAGGAAGCAAATTCTAAGACCTCAGGGTGTCTTTCTGAGTCTCTCAT

TTCTTTAGGGATGTGGAGAGAAGATGAAGTATAGCCGTGTGTAGTGTCGCCAGAGAAGGTGGAGTTTAAGAATGGTCTCAGTGTTATTAATGAGAAAAAG

TTCTGTCATTCAGGAAAAAAAAGCAAAAAACGTGAGGTTGGGACTCAGTAGGTGAGGGTGCTTGCAGCCAAACCTGATGACCTGCATTCAATTCCTGGGT

CCCACGGGACAGAGGGAGAGAGTCCACTACTGAAAGGAACGCTCAAACCTCCTCACACAGGTCCTTGTGCCTGGGCACTCCCCCGCCCCATATGCATACA

CACATACATGCTTTTGTGATTTTTTTTATTAGTGCTTTTACATTTAGAAATATTTATTTATTCTAGCAGGGAAAAAACCCCACATGCTTTAAATGATGTC

ACTTTCCACAACTTCATTCTTGTGCTGTCATTGGACTGAATGTTATGCATCTTTAAAGGGAATCACTTCGTGTAAAACTCTCTTGTCTCTTCTGCTGAAA

AGTAAAATGGGTTGTGTCGGGTAATAAAGGGTCGAGGGGTAGGAAGCACTTGGTCAAGGCGAAGTCTAAAACCGGTCTCTTTTTTATTTGTTACTTGGAT

GAGAGCACCTGAAGACTAATGTTTTACACTGGATTGAGATCTCATGGAAAATGAAACATTCTTTTTCTGGAGAAGTTTACATGCCCATTGTTGGTCACCT

CTTTACTGTAAATACTATTGAAAAAAGGAGCGTAGCATTTGCATAGCAGGGATTGTGCCTGTATCTACTGTGTCCATTTTGTTTTTTCGGATGTTTTCTG

GTTTTGTTTCCTTGGAAATAAATTAATATATTGTTTTCCACCTTC
Translation
MGSWKYSLFSLSLIAALMLMFMYDRKLWKNYHFPRAVSNISVLAEVCLQMFSGESFYTADSARKTTLENFTCPEYKIQNHYITETLSEEEARFPLAFTLT

IHKDYDTFERLFRAIYMPQNVYCVHVDSKATDTFKEEVRQLLSCFPNAFLASRMEPVVYGGFSRLQADLNCMKDLVASKIPWKYVLNTCGQDFPLKTNKE

IVQYLKRFIGKNLTPGVLPPAHAVGRTKYVHQELLDHKNPYVHNTARLKAPPPHNLTIYFGTAYVALTREFANFVLKDQRSVDLISWSKDTYSPDEHFWV

TLNRIPG - UNI11477 - - UNI15894 - - UNI30239 - - UNI30903 - GVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHG - UNI1

2910 - GHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF

For any suggestions or comments, please send an email to unitrap@crg.es