Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021395 (Spin1)
Chromosomal location
Chr 13: 51196249 - 51247915 (+)
Description
spindlin 1 Gene [Source:MGI Symbol;Acc:MGI:109242]
RefSeq_dna
NM_146043 
RefSeq_peptide
NP_035592.1 NP_666155.1 
UniGene
Mm.396483 Mm.413479 Mm.472898 Mm.188432 
MGI
MGI:109242 
Uniprot/SWISSPROT
Q61142 
Uniprot/SPTREMBL
Q3TQU6 Q3TLF7 Q3UX91 
Human Ortholog
ENSG00000106723 (SPIN1)
Omim not available
UniTrap UNI10501
Vector Insertion
Chr 13: 51196360 - 51218456
Public Clones (sanger) P024C11 (ggtc) E089G03 (ggtc) D005F09 (ggtc) E123H02 (ggtc)
D100E02 (ggtc) E123A05 (ggtc) D035E11 (ggtc) P101C08 (ggtc) E085G03 (ggtc)
D001G04 (ggtc) D058E12 (ggtc) H004C03 (ggtc) E123A04 (ggtc) E022F08 (ggtc)
5SH004C03 (ggtc) IST14178H11 (tigm) IST15001D1 (tigm) IST14594D8 (tigm)
IST10907G12 (tigm) IST14820G12 (tigm) IST14786H1 (tigm) IST13549A7 (tigm)
IST15108A4 (tigm)
Private Clones OST459706 (lexicon) OST446568 (lexicon) OST422466 (lexicon) OST401648 (lexicon)
OST392787 (lexicon) OST368270 (lexicon) OST330311 (lexicon) OST319514 (lexicon)
OST271017 (lexicon) OST251562 (lexicon) OST250225 (lexicon) OST249797 (lexicon)
OST234663 (lexicon) OST232668 (lexicon) OST232367 (lexicon) OST230777 (lexicon)
OST230091 (lexicon) OST223208 (lexicon) OST220612 (lexicon) OST220011 (lexicon)
OST212266 (lexicon) OST211821 (lexicon) OST203940 (lexicon) OST200248 (lexicon)
OST194786 (lexicon) OST178387 (lexicon) OST172949 (lexicon) OST156309 (lexicon)
OST150923 (lexicon) OST141976 (lexicon) OST111676 (lexicon) OST75401 (lexicon)
OST68337 (lexicon) OST68086 (lexicon) OST53841 (lexicon) OST41631 (lexicon)
OST32113 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11326
Vector Insertion
Chr 13: 51218658 - 51223293
Public Clones (sanger) P055C11 (ggtc) E123C11 (ggtc) M070F05 (ggtc) 5SD030F09 (ggtc)
P021E04 (ggtc) 3SD010G12 (ggtc)
Private Clones OST468680 (lexicon) OST420606 (lexicon) OST355727 (lexicon) OST324945 (lexicon)
OST302262 (lexicon) OST301299 (lexicon) OST292753 (lexicon) OST255485 (lexicon)
OST242573 (lexicon) OST237189 (lexicon) OST216024 (lexicon) OST193014 (lexicon)
OST181979 (lexicon) OST175562 (lexicon) OST171899 (lexicon) OST90630 (lexicon)
OST67617 (lexicon) OST42466 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7015
Vector Insertion
Chr 13: 51223343 - 51229691
Public Clones (sanger) RRZ449 (baygenomics) IST14288H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23866
Vector Insertion
Chr 13: 51229752 - 51234725
Public Clones not available
Private Clones OST242046 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20312
Vector Insertion
Chr 13: 51234725 - 51234750
Public Clones not available
Private Clones OST367592 (lexicon) OST311505 (lexicon) OST293282 (lexicon) OST217802 (lexicon)
OST212274 (lexicon) OST207383 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25027
Vector Insertion
Chr 13: 51234980 - 51239670
Public Clones not available
Private Clones OST197782 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25209
Vector Insertion
Chr 13: 51239670 - 51239878
Public Clones not available
Private Clones OST191685 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27167
Vector Insertion
Chr 13: 51239981 - 51244330
Public Clones not available
Private Clones OST67992 (lexicon)
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095797
Sequence
ATGGCCTCTGCGTCAAGTCCTGCTTCCTGCCCCAG - UNI20312 - - UNI23866 - AAAACATCGGACCAGTGTGGGACCAAGCAAGCCTGTGT

CCCAACCCCGGCGGAACATCGTAGGCTGCAGGATCCAGCATGGATGGAGAGAGGGCAATGGCCCTGTTACCCAGTGGAAGGGGACTGTCCTGGACCAGGT

GCCTGTGAATCCTTCCCTGTATCTTATAAAGTACGATGGATTTGACTGTGTTTATGGACTAGAACTTAATAAGGATGAAAGAGTTTCTGCACTGGAAGTC

CTCCCTGATAGAGTTG - UNI25027 - - UNI25209 - CAACATCTCGGATCAGCGATGCACACTTAGCGGACACAATGATCGGCAAAGCAGTGG

AGCACATGTTTGAGACAGAGGACGGCTCTAAAGATGAGTGGAGGGGGATGGTCTTGGCACGGGCGCCTGTCATGAACACATGGTTTTACATCACCTATGA

GAAAGACCCTGTCTTGTACATGTACCAGCTCCTCGATGACTACAAAGAAGGCGACCTCCGCATCATGCCTGATTCCA - UNI27167 - ATGATTCGC

CTCCAGCAGAAAGGGAGCCAGGAGAAGTTGTGGACAGCCTGGTAGGCAAGCAAGTGGAATATGCCAAAGAAGACGGCTCGAAAAGGACTGGCATGGTCAT

CCACCAAGTAGAGGCCAAGCCCTCTGTCTATTTCATCAAGTTTGATGACGATTTCCATATTTACGTCTACGATTTGGTGAAAACATCCTAGATGTCATCA

CAAACTTTGCCAAATTTGTGGAACTATTAAATGTATAATTTGTAGACATAAAGACTTGATTGCTTTCCAGTTTAATGAAAGCTTAGATGTCCCTGCGAAC

CCACAATCTCCACCAGCAGAGCTGGTGTTGTTCTGAATAGTGCAGACTGATTCGAACACAAGGCATCTGTGAGGGGAGTCCTCCCTCTTCAAAGCATCTG

TGTGAGGGGGTCTTCCCTCTTACAAGAAAGCTGTCTGTTGGGGGTTACAAGCAAGGTGGTAAACGTTAAGCTAGTATCATAGTCATTTAAACCTGGATAG

ATTGTAACCATTTTCCCTTCACTCTGACACTGTCTTATTCTGCTGCCACAATGCAAGCATAGTTTGTTATTTTTGTTACTGCCTTTTTTGAGAGATTATG

TATCTATATAGCTACCTGTCTAGATCTGCATCTGTGTGCCTATGTATATATTATACACACACAGAGGCACTCACCGCTGGCTCTCCTTTCCTTGGGGATT

GGGGTGGGGGTGATAACGTTTTCTCCAGTTCAACAGGAGTGCTTGACCCAAGTCAGTCATATTTATAATATGCCTGCTCTTTGTTTAAAATTAAATTTGG

GCACAGGAAGCACACAGAGACATTTAGGTTGTTTAAAAAGTCAGAATTTCTGAGTACCATTTCAGTCTGGAGGCTTTTAGCTGAGTCCAGGTATAAATTA

GCCATAAACAGTCAATGACCCACAGTAGTCTTTAGTAAACTGTTGAGAAATCTGGGTAAAAGGCTGCCTTCAATTCTAAGCTTTGTTTTTTTGTGGTTTT

TGTTATTATTTGTTTCTGTTGTTTACTCTTTAATCGTAAGTACTTTTAAACCACGACCCAGGTCCTTGGTTCACATGGAATAATAAAGATGTGTTTTTAG

ATGGCACATTGGTCCATTTGTACACACCTGTCATCGGGATCTTAGTACATGGACTTAAAAGGCAACACTACATCAATGGTTTGTATATGTGGTGAATTCC

TGCAAGAACAGTGCATTTGTATTAGAAATGTAAGTTTTAAGGATGGCCTTGTTGCCTTCTATCAAGTTCTCTGGGACTTTGTAATTTTGATTACTACTAT

TGATACATGGTTATGGTCAGAAGGCCTCTTCTCCCTTCCTCCCTCACTCCCTCTCCTCCTAGCTTTCCCCACAGAGAATGTTAGACCAGTATGGCTTCTT

GCCTTGATCCTGTTGTGGCAGTGTCTGTTCCTGCCCCAGGTGTGCTATTCACGCAGGTTTATTCCCTCCATGGCCTCCGGGCTTTGCATGTCTATGATGT

GTGTGTCGCTGGGAAGGTCATGCTTGCCAGTTATGGGTGGATCGCAGCTCTTCGCCATCAAGTGCATTCAGGATTATTCCTGGGAGGTTGCTTAAAGCTG

AAATAGAACTGAAATGCAGTTGGTAGACTAGCCAAACATCTGCTTGCTCTCACTTTGTTTTGGAAGAACCATGGTAGCTTGTCAGCTGGTAGAAAGATGG

TTTGTAAAAACCAGTTTCTCACGGAGGTTGAACCTATCTGTGGCTGGACAGTCTTGGATACTGTCAAGCAAACACCAGAGGCTTGGCCAAGTATAGTTAC

AATTACCTAGTTGGGGTTCTTCCTGATGCAAGAAATTTTTCACTGTTCGAGGCACATGGTTATTGGCTATCCATTTAGTTTTCACAGAGGCTGACCACCT

TACACTGCTGGGTGGTCACAACTGCTCACCATGTGAACATAGTACCTCAGTTCTGTCCTTGGCTGCAATCGTTGTGTGCTCAGTGTTTTCTCATAGGCAC

CAGGGACAGGCTTCTCAAGGCAGTATGATATACCCTAGTCTTTGGTGCCTCTAGTATATGTGACCAGGTGTCGTCCTGCATGTAAATCTCCGAGCTGAGT

CTGACTCACAGCCCATGCTGTCATCTGTGGCACAAGTGGGTGTGAGTACGTCCTGCATGCACTAACGGTGCAGAACATGGCATGGTGACTAGAAAGTAAA

ACTCCTTTTGAAGTGTCCCAAGGACTGGGTCAGTTAGAACCTGTCTGCCACTATCTGATGACTTACATTGTGGTTTTCTACAAGCCACCTCAGTTAACTT

TGGTTCCCCGTGGACTCCCAGGCTGGAGGAGGAAAGCGTGAGGACGGGGATGATTTTGATCACGATTCCATTTATTGCCTTTACATAAGGTTGAGGGAAG

GGGAAGGTTTGGTTTGTTTGTCTTTTAATTGTTTTTTTTTTCTTTTTTTTTTTTTTAATTCCCCCACCCCACCCTCTTTCTTTTGGTGGCTTCCACCACC

CTTAATGGTGACAGACTCCTGGGCCTGCCACCTTGGACTTCCCTTAGGCTCACAGTTCAGATCTGCATGCATTGCTTGCATTGTTCTGGTATCTGAATGT

TGATTCCTCATTTAGGAGTTCAGCATTAATTTCCAAAATTTTCATGGGGCTTGTGGCAACACGGGCCGTGAATCTGTGTATAAAATTTACTGGCCTTCTT

CACTTACCTGCTCTAGTATCGTATCGTGTGTGCGTGCGTGTGTGACGTCAGGCTGCCACGTAAACTTCAGAGAAGAACCTTAAAGCAGACCATCCATTTT

TGCATGCTCTCTTCTAAGTAGAATGTTCAATGTAACTAAAACTAAAATTGCATGTCAAAGAGACCTAGGTTCTTTCTTTCTTTCTTTCTCTCTTTCTTTC

AGTTTGCTTTTGGTTTCCTGTATATTTGCTTACTGTGCTGTTCTAGTGGTTGTAGGGTAAAGACGAACTGGTGAAGCAGTCGTAGCGCCGACCGAAGGTG

ATTCCAGTTGTATATGTCACGCAGCATTCGAAGGGACTGTGCACGCTCTAAAGATCACAGTTGCTTCTAAGCCAGATTTCATTTCTATTCTTGTTTTATG

TGCCAAACCCCAAAGTGCATTGGGCCTGAATCTCTGAACACTGTAGACCCATTAGAAGGAAGATTGTTCTGACCGTCACAAATTGTAGTGCCTGAAAACA

CTTAACACTGATTGTCTAAGAGATGAAAGTCCTCCAAAGATGACACAGGAAAAATACTACAAGTAATTGTGGTGGAAATGTCTGTGTTCCTTGGGAATGC

TGCGCTCTCTGTAGTTTCCATCATTGGTGCAGTTCGAACGAATGAGTAGAGTTCAGAGGTCTTCGTGTTCACATTTAAAACTAGATAAATGACCTCATTT

TCTTGAGCTTGAATTCATTTTTAATTTTAATTTTATTTTATACAACGTGTAGACGGTTCCCTGTTCTCTGCATTTAGAAGTATACACAGTACAACTGTTA

ATTCTGTAAGTAATTTTTATAATTATGATGTAACTCTTATCCTTCCTTAAAACATTAAAATAAACCCTTTATGTGC
Translation
MASASSPASCPR - UNI20312 - - UNI23866 - RKHRTSVGPSKPVSQPRRNIVGCRIQHGWREGNGPVTQWKGTVLDQVPVNPSLYLIKYDGF

DCVYGLELNKDERVSALEVLPDRVA - UNI25027 - - UNI25209 - ATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWF

YITYEKDPVLYMYQLLDDYKEGDLRIMPDSN - UNI27167 - NDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDF

HIYVYDLVKTS
Transcript ENSMUST00000099517
Sequence
ATGGCCTCTGCGTCAAGTCCTGCTTCCTGCCCCAG - UNI20312 - - UNI23866 - AAAACATCGGACCAGTGTGGGACCAAGCAAGCCTGTGT

CCCAACCCCGGCGGAACATCGTAGGCTGCAGGATCCAGCATGGATGGAGAGAGGGCAATGGCCCTGTTACCCAGTGGAAGGGGACTGTCCTGGACCAGGT

GCCTGTGAATCCTTCCCTGTATCTTATAAAGTACGATGGATTTGACTGTGTTTATGGACTAGAACTTAATAAGGATGAAAGAGTTTCTGCACTGGAAGTC

CTCCCTGATAGAGTTG - UNI25027 - - UNI25209 - CAACATCTCGGATCAGCGATGCACACTTAGCGGACACAATGATCGGCAAAGCAGTGG

AGCACATGTTTGAGACAGAGGACGGCTCTAAAGATGAGTGGAGGGGGATGGTCTTGGCACGGGCGCCTGTCATGAACACATGGTTTTACATCACCTATGA

GAAAGACCCTGTCTTGTACATGTACCAGCTCCTCGATGACTACAAAGAAG - UNI25209 - GAAG - UNI27167 - CTCACTTTGTTTTGGAAG

AACCATGGTAGCTTGTCAGCTGGTAGAAAGATGGTTTGTAAAAACCAGTTTCTCACGGAGGTTGAACCTATCTGTGGCTGGACAGTCTTGGATACTGTCA

AGCAAACACCAGAGGCTTGGCCAAGTATAG
Translation
MASASSPASCPR - UNI20312 - - UNI23866 - RKHRTSVGPSKPVSQPRRNIVGCRIQHGWREGNGPVTQWKGTVLDQVPVNPSLYLIKYDGF

DCVYGLELNKDERVSALEVLPDRVA - UNI25027 - - UNI25209 - ATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWF

YITYEKDPVLYMYQLLDDYKEG - UNI25209 - GS - UNI27167 - SSLCFGRTMVACQLVERWFVKTSFSRRLNLSVAGQSWILSSKHQRLGQ

V
Transcript ENSMUST00000099516
Sequence
AGCAAGCCAGTAAGAAACATCCTCCATGGCCTCTGCGTCAAGTCCTGCTTCCTGCCCCAG - UNI20312 - - UNI23866 - AAAACATCGGACC

AGTGTGGGACC - UNI20312 - AGCAAGCCTGTGTCCCAACCCCGGCGGAACATCGTAGGCTGCAGGATCCAGCATGGATGGAGAGAGGGCAATGGC

CCTGTTACCCAGTGGAAGGGGACTGTCCTGGACCAGGTGCCTGTGAATCCTTCCCTGTATCTTATAAAGTACGATGGATTTGACTGTGTTTATGGACTAG

AACTTAATAAGGATGAAAGAGTTTCTGCACTGGAAGTCCTCCCTGATAGAGTTG - UNI25027 - - UNI25209 - CAACATCTCGGATCAGCGA

TGCACACTTAGCGGACACAATGATCGGCAAAGCAGTGGAGCACATGTTTGAGACAGAGGACGGCTCTAAAGATGAGTGGAGGGGGATGGTCTTGGCACGG

GCGCCTGTCATGAACACATGGTTTTACATCACCTATGAGAAAGACCCTGTCTTGTACATGTACCAGCTCCTCGATGACTACAAAGAAGGCGACCTCCGCA

TCATGCCTGATTCCA - UNI27167 - ATGATTCGCCTCCAGCAGAAAGGGAGCCAGGAGAAGTTGTGGACAGCCTGGTAGGCAAGCAAGTGGAATAT

GCCAAAGAAGACGGCTCGAAAAGGACTGGCATGGTCATCCACCAAGTAGAGGCCAAGCCCTCTGTCTATTTCATCAAGTTTGATGACGATTTCCATATTT

ACGTCTACGATTTGGTGAAAACATCCTAG
Translation
SKPVRNILHGLCVKSCFLPQ - UNI20312 - - UNI23866 - KTSDQCGT - UNI20312 - SKPVSQPRRNIVGCRIQHGWREGNGPVTQWK

GTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVA - UNI25027 - - UNI25209 - ATSRISDAHLADTMIGKAVEHMFETED

GSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSN - UNI27167 - NDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTG

MVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS
Transcript ENSMUST00000057478
Sequence
GGCGGCCGCGGCGAGGAGCGGGGGTGGGGAGGCGCCGTCTGGCTCGGGCTGGGCCGGCGGGGAGCACGAGCGAACCACGGCGGCCCCGTGGGCAGCCTCG

GTGGCCGACAG - UNI10501 - AGTGCTTGGGATCCCGTGTGTTTTTGCTGAACTTGTAAAGGAGACATCTGGATGGTGGATTAACACGAACCTGTG

GGCAGCCTCATAGCTGAGAACATTGGATTTTCACCCTAGTCCAGCAGCTCTGCTGCTCACATAGATACAGATGAATGAAGACCCCATTCGGGAAGACACC

TGGCCAACGGTCCAGAGCTGATGCAG - UNI11326 - GCCATGCTGGAGTATCTGCAAACATGATGAAGAAGAGGACATCTCACAA - UNI7015 

- - UNI20312 - - UNI23866 - AAAACATCGGACCAGTGTGGGACCAAGCAAGCCTGTGTCCCAACCCCGGCGGAACATCGTAGGCTGCAGGAT

CCAGCATGGATGGAGAGAGGGCAATGGCCCTGTTACCCAGTGGAAGGGGACTGTCCTGGACCAGGTGCCTGTGAATCCTTCCCTGTATCTTATAAAGTAC

GATGGATTTGACTGTGTTTATGGACTAGAACTTAATAAGGATGAAAGAGTTTCTGCACTGGAAGTCCTCCCTGATAGAGTTG - UNI25027 - - UN

I25209 - CAACATCTCGGATCAGCGATGCACACTTAGCGGACACAATGATCGGCAAAGCAGTGGAGCACATGTTTGAGACAGAGGACGGCTCTAAAGA

TGAGTGGAGGGGGATGGTCTTGGCACGGGCGCCTGTCATGAACACATGGTTTTACATCACCTATGAGAAAGACCCTGTCTTGTACATGTACCAGCTCCTC

GATGACTACAAAGAAGGCGACCTCCGCATCATGCCTGATTCCA - UNI27167 - ATGATTCGCCTCCAGCAGAAAGGGAGCCAGGAGAAGTTGTGGA

CAGCCTGGTAGGCAAGCAAGTGGAATATGCCAAAGAAGACGGCTCGAAAAGGACTGGCATGGTCATCCACCAAGTAGAGGCCAAGCCCTCTGTCTATTTC

ATCAAGTTTGATGACGATTTCCATATTTACGTCTACGATTTGGTGAAAACATCCTAGATGTCATCACAAACTTTGCCAAATTTGTGGAACTATTAAATGT

ATAATTTGTAGACATAAAGACTTGATTGCTTTCCAGTTTAATGAAAGCTTAGATGTCCCTGCGAACCCACAATCTCCACCAGCAGAGCTGGTGTTGTTCT

GAATAGTGCAGACTGATTCGAACACAAGGCATCTGTGAGGGGAGTCCTCCCTCTTCAAAGCATCTGTGTGAGGGGGTCTTCCCTCTTACAAGAAAGCTGT

CTGTTGGGGGTTACAAGCAAGGTGGTAAACGTTAAGCTAGTATCATAGTCATTTAAACCTGGATAGATTGTAACCATTTTCCCTTCACTCTGACACTGTC

TTATTCTGCTGCCACAATGCAAGCATAGTTTGTTATTTTTGTTACTGCCTTTTTTGAGAGATTATGTATCTATATAGCTACCTGTCTAGATCTGCATCTG

TGTGCCTATGTATATATTATACACACACAGAGGCACTCACCGCTGGCTCTCCTTTCCTTGGGGATTGGGGTGGGGGTGATAACGTTTTCTCCAGTTCAAC

AGGAGTGCTTGACCCAAGTCAGTCATATTTATAATATGCCTGCTCTTTGTTTAAAATTAAATTTGGGCACAGGAAGCACACAGAGACATTTAGGTTGTTT

AAAAAGTCAGAATTTCTGAGTACCATTTCAGTCTGGAGGCTTTTAGCTGAGTCCAGGTATAAATTAGCCATAAACAGTCAATGACCCACAGTAGTCTTTA

GTAAACTGTTGAGAAATCTGGGTAAAAGGCTGCCTTCAATTCTAAGCTTTGTTTTTTTGTGGTTTTTGTTATTATTTGTTTCTGTTGTTTACTCTTTAAT

CGTAAGTACTTTTAAACCACGACCCAGGTCCTTGGTTCACATGGAATAATAAAGATGTGTTTTTAGATGGCACATTGGTCCATTTGTACACACCTGTCAT

CGGGATCTTAGTACATGGACTTAAAAGGCAACACTACATCAATGGTTTGTATATGTGGTGAATTCCTGCAAGAACAGTGCATTTGTATTAGAAATGTAAG

TTTTAAGGATGGCCTTGTTGCCTTCTATCAAGTTCTCTGGGACTTTGTAATTTTGATTACTACTATTGATACATGGTTATGGTCAGAAGGCCTCTTCTCC

CTTCCTCCCTCACTCCCTCTCCTCCTAGCTTTCCCCACAGAGAATGTTAGACCAGTATGGCTTCTTGCCTTGATCCTGTTGTGGCAGTGTCTGTTCCTGC

CCCAGGTGTGCTATTCACGCAGGTTTATTCCCTCCATGGCCTCCGGGCTTTGCATGTCTATGATGTGTGTGTCGCTGGGAAGGTCATGCTTGCCAGTTAT

GGGTGGATCGCAGCTCTTCGCCATCAAGTGCATTCAGGATTATTCCTGGGAGGTTGCTTAAAGCTGAAATAGAACTGAAATGCAGTTGGTAGACTAGCCA

AACATCTGCTTGCTCTCACTTTGTTTTGGAAGAACCATGGTAGCTTGTCAGCTGGTAGAAAGATGGTTTGTAAAAACCAGTTTCTCACGGAGGTTGAACC

TATCTGTGGCTGGACAGTCTTGGATACTGTCAAGCAAACACCAGAGGCTTGGCCAAGTATAGTTACAATTACCTAGTTGGGGTTCTTCCTGATGCAAGAA

ATTTTTCACTGTTCGAGGCACATGGTTATTGGCTATCCATTTAGTTTTCACAGAGGCTGACCACCTTACACTGCTGGGTGGTCACAACTGCTCACCATGT

GAACATAGTACCTCAGTTCTGTCCTTGGCTGCAATCGTTGTGTGCTCAGTGTTTTCTCATAGGCACCAGGGACAGGCTTCTCAAGGCAGTATGATATACC

CTAGTCTTTGGTGCCTCTAGTATATGTGACCAGGTGTCGTCCTGCATGTAAATCTCCGAGCTGAGTCTGACTCACAGCCCATGCTGTCATCTGTGGCACA

AGTGGGTGTGAGTACGTCCTGCATGCACTAACGGTGCAGAACATGGCATGGTGACTAGAAAGTAAAACTCCTTTTGAAGTGTCCCAAGGACTGGGTCAGT

TAGAACCTGTCTGCCACTATCTGATGACTTACATTGTGGTTTTCTACAAGCCACCTCAGTTAACTTTGGTTCCCCGTGGACTCCCAGGCTGGAGGAGGAA

AGCGTGAGGACGGGGATGATTTTGATCACGATTCCATTTATTGCCTTTACATAAGGTTGAGGGAAGGGGAAGGTTTGGTTTGTTTGTCTTTTAATTGTTT

TTTTTTTCTTTTTTTTTTTTTTAATTCCCCCACCCCACCCTCTTTCTTTTGGTGGCTTCCACCACCCTTAATGGTGACAGACTCCTGGGCCTGCCACCTT

GGACTTCCCTTAGGCTCACAGTTCAGATCTGCATGCATTGCTTGCATTGTTCTGGTATCTGAATGTTGATTCCTCATTTAGGAGTTCAGCATTAATTTCC

AAAATTTTCATGGGGCTTGTGGCAACACGGGCCGTGAATCTGTGTATAAAATTTACTGGCCTTCTTCACTTACCTGCTCTAGTATCGTATCGTGTGTGCG

TGCGTGTGTGACGTCAGGCTGCCACGTAAACTTCAGAGAAGAACCTTAAAGCAGACCATCCATTTTTGCATGCTCTCTTCTAAGTAGAATGTTCAATGTA

ACTAAAACTAAAATTGCATGTCAAAGAGACCTAGGTTCTTTCTTTCTTTCTTTCTCTCTTTCTTTCAGTTTGCTTTTGGTTTCCTGTATATTTGCTTACT

GTGCTGTTCTAGTGGTTGTAGGGTAAAGACGAACTGGTGAAGCAGTCGTAGCGCCGACCGAAGGTGATTCCAGTTGTATATGTCACGCAGCATTCGAAGG

GACTGTGCACGCTCTAAAGATCACAGTTGCTTCTAAGCCAGATTTCATTTCTATTCTTGTTTTATGTGCCAAACCCCAAAGTGCATTGGGCCTGAATCTC

TGAACACTGTAGACCCATTAGAAGGAAGATTGTTCTGACCGTCACAAATTGTAGTGCCTGAAAACACTTAACACTGATTGTCTAAGAGATGAAAGTCCTC

CAAAGATGACACAGGAAAAATACTACAAGTAATTGTGGTGGAAATGTCTGTGTTCCTTGGGAATGCTGCGCTCTCTGTAGTTTCCATCATTGGTGCAGTT

CGAACGAATGAGTAGAGTTCAGAGGTCTTCGTGTTCACATTTAAAACTAGATAAATGACCTCATTTTCTTGAGCTTGAATTCATTTTTAATTTTAATTTT

ATTTTATACAACGTGTAGACGGTTCCCTGTTCTCTGCATTTAGAAGTATACACAGTACAACTGTTAATTCTGTAAGTAATTTTTATAATTATGATGTAAC

TCTTATCCTTCCTTAAAACATTAAAATAAACCCTTTATGTGC
Translation
 - UNI10501 - MKTPFGKTPGQRSRADAG - UNI11326 - GHAGVSANMMKKRTSHK - UNI7015 - - UNI20312 - - UNI23866 

- KKHRTSVGPSKPVSQPRRNIVGCRIQHGWREGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVA - UNI25027 

- - UNI25209 - ATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSN - UNI

27167 - NDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

For any suggestions or comments, please send an email to unitrap@crg.es