Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021408 (Ripk1)
Chromosomal location
Chr 13: 34094266 - 34125548 (+)
Description
receptor (TNFRSF)-interacting serine-threonine kinase 1 Gene [Source:MGI Symbol;Acc:MGI:108212]
RefSeq_dna
NM_009068 
RefSeq_peptide
NP_033094.3 
UniGene
Mm.374799 
MGI
MGI:108212 
Uniprot/SWISSPROT
Q60855 
Human Ortholog
ENSG00000137275 (RIPK1)
Omim not available
UniTrap UNI1847
Vector Insertion
Chr 13: 34109016 - 34113249
Public Clones AZ0812 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6650
Vector Insertion
Chr 13: 34113327 - 34118610
Public Clones RHA303 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021844
Sequence
AGTAGTCCTTAGAGGAGGACCAGCGGCCCCCGGAACGGCCTCGGGAGCGCGGGTGTCGGTGCCGCTCACCTCCCGGGAGTCCAGCGGCGGTGCGGACCCG

CGGAGGTGCGAGCTGGACGCGGCGGGAGGCGGCAGGCTGTGGGGGACCTGCGAGTGGCTGGGCGCCACTTCAGCACCGAACTCCGACCGGTCCTCGTCAG

GGCCCAGGGCCGTCCCGGCCGGGCAGCCACGGCGAGGCGCCGCTCCTGACGTCCACCGCCCGTCCTTCCTCACCTAGGCCGGGGTACTTGGCCGCGGGAA

GGCCTCTGAG GACACAGCACTAAGCAAGAACCAAAAGTGGTGTGTTGGAGATTCTGAGCAATCAAAATGCAACCAGACATGTCCTTGGACAATATTAAG

ATGGCATCCAGTGACCTGCTGGAGAAGACAGACCTAGACAGCGGAGGCTTCGGGAAGGTGTCCTTGTGTTACCACAGAAGCCATGGATTTGTCATCCTGA

AAAAAGTATACACAGGGCCCAACCGCGCTGA GTACAATGAGGTTCTCTTGGAAGAGGGGAAGATGATGCACAGACTGAGACACAGTCGAGTGGTGAAGC

TACTGGGCATCATCATAGAAGAAGGGAACTATTCGCTGGTGATGGAGTACATGGAGAAGGGCAACCTGATGCACGTGCTAAAGACCCAG ATAGATGTCC

CACTTTCATTGAAAGGAAGGATAATCGTGGAGGCCATAGAAGGCATGTGCTACTTACATGACAAAGGTGTGATACACAAGGACCTGAAGCCTGAGAATAT

CCTCGTTGATCGTGACTTTCACATTAAG ATAGCCGATCTTGGTGTGGCTTCCTTTAAGACATGGAGCAAACTGACTAAGGAGAAAGACAACAAGCAGAA

AGAAGTGAGCAGCACCACTAAGAAGAACAATGGTGGTACCCTTTACTACATGGCACCCGAACACCTGAATGACATCAATGCAAAGCCCACGGAGAAGTCG

GACGTGTACAGCTTTGGCATTGTCCTTTGGGCAATATTTGCAAAAAAGGAGCCCTATGAGA ATGTCATCTGTACTGAGCAGTTCGTGATCTGCATAAAA

TCTGGGAACAGGCCAAATGTAGAGGAAATCCTTGAGTACTGTCCAAGGGAGATCATCAGCCTCATGGAGCGGTGCTGGCAGGCGATCCCAGAAGACAGGC

CAACATTTCTTG - UNI1847 - GCATTGAAGAAGAATTTAGGCCTTTTTACTTAAGTCATTTTGAAGAATATGTAGAAGAGGATGTGGCAAGTTTAA

AG - UNI6650 - AAAGAGTATCCAGATCAAAGCCCAGTGCTGCAGAGAATGTTTTCACTGCAGCATGACTGTGTACCCTTACCTCCGAGCAGGTCAA

ATTCAG AACAACCTGGATCGCTGCACAGTTCCCAGGGGCTCCAGATGGGTCCTGTGGAGGAGTCCTGGTTTTCTTCCTCCCCAGAGTACCCACAGGACG

AGAATGATCGCAGTGTGCAGGCTAAGCTGCAAGAGGAAGCCAGCTATCATGCTTTTGGAATATTTGCAGAGAAACAGACAAAACCGCAGCCAAGGCAGAA

TGAGGCTTACAACAGAGAGGAGGAAAGGAAACGAAGGGTCTCTCATGACCCCTTTGCACAGCAGAGAGCTCGTGAGAATATTAAGAGTGCAGGAGCAAGA

GGTCATTCTGATCCCAGCACAACGAGTCGTGGAATTGCAGTGCAACAGCTGTCATGGCCAGCCACCCAAACAGTTTGGAACAATGGATTGTATAATCAGC

ATGGATTTGGAACTACAGGTACAGGAGTTTGGTATCCGCCAAATCTAAGCCAAATGTATAGTACTTATAAAACTCCAGTGCCAGAGACCAACATACCGGG

AAGCACACCCACCATGCCATACTTCTCTGGGCCAGTAGCAG ATGACCTCATAAAATATACTATATTCAATAGTTCTGGTATTCAGATTGGAAACCACAA

TTATATGGATGTTGGACTGAATTCACAACCACCAAACAATACTTGCAAAGAAGAGTCGACTTCCAGACACCAAGCCATCTTTG ATAACACCACTAGTCT

GACTGATGAACACCTGAACCCTATCAGGGAAAACCTGGGAAGGCAGTGGAAAAACTGTGCCCGCAAGCTGGGCTTCACTGAGTCTCAGATCGATGAAATC

GACCATGACTATGAAAGAGATGGACTGAAAGAGAAAGTTTACCAAATGCTTCAGAAGTGGCTGATGCGGGAAGGCACCAAAGGGGCCACAGTGGGAAAGT

TGGCCCAGGCACTTCACCAATGTTGCAGGATAGACCTGCTGAACCACTTGATTCGTGCCAGCCAGAGCTAAGCCTGGGCAGGCTCTGGCAGTGGGAAGCA

AACTATTTGTCTGGTGCACAAACCCCGTTTGCCCACTAGCCTTCAGAACTCTATCTCAGCATGAGCTCTGCATTTGAGCACACAGGGTCATGCAGTTTGG

AACTGGTGGATGGGAAGAGAAATCTGAAGCCCACAGTGATTCTTCAGAACATGCAAGCATAAAGACCGCTGAATGAATGGTCGGTCCATGACCAGTAGGA

GGAAAAAAATTAAAAATACAGTGTATTGAGTTTTCAAAGGGAGAGAAGATGTTGGGGGAAGGTGGCCTTCGTTCAGCTTGTGTCATAGTCATCACTTAGG

TTATTTGCTCAGTTTCCTGTGGTTTCATTGGGTAAGGGGAAAACAAACAAAAAACATTCAAAGAATGTAAAATCAGCTAGCTTCCCGCTTCATGGACTGT

GAGTCAGAAAAGTTCTGCTCAAATGCCTTCTATGAGCCACGGCTCTTCTAAAAACTATAGGATCTGTTAACTTGAGCATCCAATGCTGTACTGTCACCTT

AAGCTTTAAGAATCATGTGTAATTCTAGTCTATCAAATTATCAATTAGTGAGAGATTTTTAAGGAGTGCTAAGGAGAAAAAGGTGCAGGGCAGAGAGAGA

TCTTCAGGTACTGGCTGTCATTGCAGCTCAGGTACTGGCTGTCATTGCAGAGCTGCTGCTGGTTCTGGCTGCTGTAAAAAGTCTACTTTTAAGTTTCTAA

AGTTTCTCTACCATTCTGGCGCTTCATGCAGTTTCCCACCCTGTGAGCCCCACAGAGGGAACAGATGTGCAGGAAACACTGATCGGGAAATACCATCTCC

TCCTCTCTGGATATGACTGGTGCCTTAGCACTGTTCCCTGTGCCCAATAAACTGTTTCCTCAGTTTTC
Translation
 MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRAE EYNEVLLEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEK

GNLMHVLKTQ IDVPLSLKGRIIVEAIEGMCYLHDKGVIHKDLKPENILVDRDFHIK IADLGVASFKTWSKLTKEKDNKQKEVSSTTKKNNGGTLYYMA

PEHLNDINAKPTEKSDVYSFGIVLWAIFAKKEPYEN NVICTEQFVICIKSGNRPNVEEILEYCPREIISLMERCWQAIPEDRPTFLG - UNI1847 -

 GIEEEFRPFYLSHFEEYVEEDVASLK - UNI6650 - KEYPDQSPVLQRMFSLQHDCVPLPPSRSNSE EQPGSLHSSQGLQMGPVEESWFSSSPEY

PQDENDRSVQAKLQEEASYHAFGIFAEKQTKPQPRQNEAYNREEERKRRVSHDPFAQQRARENIKSAGARGHSDPSTTSRGIAVQQLSWPATQTVWNNGL

YNQHGFGTTGTGVWYPPNLSQMYSTYKTPVPETNIPGSTPTMPYFSGPVAD DDLIKYTIFNSSGIQIGNHNYMDVGLNSQPPNNTCKEESTSRHQAIFD

 DNTTSLTDEHLNPIRENLGRQWKNCARKLGFTESQIDEIDHDYERDGLKEKVYQMLQKWLMREGTKGATVGKLAQALHQCCRIDLLNHLIRASQS

For any suggestions or comments, please send an email to unitrap@crg.es