Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021428 (Riok1)
Chromosomal location
Chr 13: 38129164 - 38153298 (+)
Description
RIO kinase 1 (yeast) Gene [Source:MGI Symbol;Acc:MGI:1918590]
RefSeq_dna
NM_024242 
RefSeq_peptide
NP_077204.2 
UniGene
Mm.297130 Mm.395521 
MGI
MGI:1918590 
Uniprot/SWISSPROT
Q922Q2 
Human Ortholog
ENSG00000124784 (RIOK1)
Omim not available
UniTrap UNI7976
Vector Insertion
Chr 13: 38132144 - 38134919
Public Clones RRI293 (baygenomics)
Private Clones OST390215 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021866
Sequence
CTGTATCCTGACACCCCGGTGGCGCCTGGTCGTTGCCTTCTTGGGCCTGGCGGTTGCCGAGGGATTTGAGGGGCGGGAATCGCGGAGACGCGTTTGGATC

CTCTAGGTGGGAAGCAGGCTCTTCCGATCGCGGCCTCAGGGGCGCCGAAGGCTCACACCCCTAGCCATGGACTGCAGTCTGGACAGGATGGCTTCGGTGG

TCCCCGGGCAATTTGACGACGCGGATTCCTCAGACAG TGAAAACAAAGAACTGCAGCCAATCCATGCAGAAGATGGCGGCGTTCTACTTAAAAGCCTCC

AGAATGCTGCAGCAGAGGTGAAGGGCGACGCTGAGACCGATGAGGAAGACGACTATGATGATGATGATGATTGGTACTTGGACGATGCAACTGGAAAACT

CACCAAGGGTTGTACCTGGAATGGCGGCAGTAACTATCAG - UNI7976 - GCAAACCGACAGACTTCTAACTACAATTCAGCCAAAATGTCTACTCC

AATTGACAAGTCCTTGCGAAAATTTGAAAATAAAATCAATCTAA ATAAGCTGAATGTTACTGATTCTGTGACAAATAAAGTCACCGTAAAATTGAGACA

AAAGGAAGCAGAATC GTATCGAATTAAAGATAAGGCCGACAGAGCAACCGTAGAACAG GTTTTGGATCCCAGAACAAGGATGATTTTATTCAAGTTGT

TGCATAAAGACCACATATCAGAGATACATGGCTGTATTAGCACTGGAAAAGAA GCTAATGTATACTATGCTAGCACACCCAGTGGAGAGAGCAGAGCAA

TCAAAATATACAAAACTTCTATTTTGATGTTCAAAGATCGTGATAAGTATGTGACTGGGGAATTCAG GTTCCGGCGTGGCTATTGTAAAGGAAACCCTA

GGAAAATGGTGAGGACGTGGGCAGAGAAGGAGATGAGGAATTTGTGCAG GCTAAAAACAGCAAACATACCATGTCCAGAACCAATCAGGCTAAGAAGTC

ATGTTCTTCTCATGGGCTTCATTGGCAAGGATGACAT GCCAGCCCCACTTTTGAAAAATGTCCAGCTGTCAGAGTCCAAGGCACGGGAGTTGTACCTGC

AGGTCATTCAGTACATGAGGAAAATGTATCAGGACGCTAGACTTGTCCACGCGGATCTCAGTGAATTCAACATGCT GTACCATGGTGGAGATGTTTACA

TCATTGATGTTTCTCAGTCTGTGGAGCATGACCACCCACATGCATTGGAGTTCTTGAGAAAAGACTGTACCAATGTCAATG ATTTCTTTTCCAAGCATG

CTGTTGCAGTGATGACCGTGCGGGAGCTCTTCGACTTCGTCACAGATCCCTCCATCACTGCTGACAACATGGATGCTTACCTGGAAAAG GCTATGGAAA

TAGCATCCCAGAGGACCAAGGAAGAAAAGACTAGCCAAGATCATGTGGATGAAGAG GTGTTCAAACAAGCATATATTCCCAGAACCTTAAACGAAGTAA

AGAATTATGAGAGAGATGTGGACATCATGATGAGGTTAAAGGAAGAAGACATGGCTTTGAACACTCAGCAAGACAAC ATTCTATACCAGACTGTCATGG

GATTGAAAAAAGATTTGTCAGGAGTCCAGAAG GTCCCCGCGCTCCTAGAAAGTGAAGTTAAGGAAGAGACTTGTTTTGGTTCAGACGATGCTGGGGGCT

CTGAGTGCTCCGACACAGTCTCTGAAGAGCAGGAAGATCAAGCCGGATGCAGAAACCATATTGCTGACCCTGACATTGATAAAAAG GAAAGAAAAAAGA

TGGTCAAGGAAGCCCAGAGAGAGAAGAGAAAAAATAAAATCCCTAAACATGTGAAAAAAAGAAAGGAAAAAACAGCCAAGGCCAAAAAAGGCAAATAGAA

TGGAGCCATTCCTCGGCTACATTTTAACCCTGAAACAGAAGTAGCTGGAGGAGGCTTCCTCACTGTCTCACTGTCAGAGGAGGCTGGGGTGTGGTCATGT

GATTGTTTCAAAAGCCTATTCTTTCGGGATCCAGTCCTGGCTCTGCTTTTAACGGACTTATTAAGGTATTATTTTAATGAAGAACTTTGTATATTTTATT

TTTATATTTTTATCTTGCAAACATTTTCCCACAAGTATCAGAACATGAGTGTTTATGATGAACATCCACGGACGAACTTGGGAACATTTGTTTTCTTTGT

CTATGCCAAAGACATATCTGAAACAGCCTGGAGCTCCGCTCCGAGAGACATCGTCTGGCCGTTATGTGCCATTCCCAGGAGCCCTGTTCCTGTGTGTTCT

GGATACACAGGAAGCTGTCCTATGATCCTGCTTCATCTTAACTATACCTTTCCAGTGAGCCCTCCCAGCTCAGGTGCCATTTCACACCCAGCCATTTGTT

CATCAGATATTTCAGTGTTCTAGGAACTGGGATATAGCTATGAATAAAACCACATTACTTCC
Translation
MDCSLDRMASVVPGQFDDADSSDS SENKELQPIHAEDGGVLLKSLQNAAAEVKGDAETDEEDDYDDDDDWYLDDATGKLTKGCTWNGGSNYQ - UNI7

976 - ANRQTSNYNSAKMSTPIDKSLRKFENKINLN NKLNVTDSVTNKVTVKLRQKEAES SYRIKDKADRATVEQ VLDPRTRMILFKLLHKDHISE

IHGCISTGKE ANVYYASTPSGESRAIKIYKTSILMFKDRDKYVTGEFR RFRRGYCKGNPRKMVRTWAEKEMRNLCR RLKTANIPCPEPIRLRSHVLL

MGFIGKDDM MPAPLLKNVQLSESKARELYLQVIQYMRKMYQDARLVHADLSEFNML LYHGGDVYIIDVSQSVEHDHPHALEFLRKDCTNVND DFFSK

HAVAVMTVRELFDFVTDPSITADNMDAYLEK AMEIASQRTKEEKTSQDHVDEE VFKQAYIPRTLNEVKNYERDVDIMMRLKEEDMALNTQQDN ILYQ

TVMGLKKDLSGVQK VPALLESEVKEETCFGSDDAGGSECSDTVSEEQEDQAGCRNHIADPDIDKK ERKKMVKEAQREKRKNKIPKHVKKRKEKTAKAK

KGK

For any suggestions or comments, please send an email to unitrap@crg.es