Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021451 (Sema4d)
Chromosomal location
Chr 13: 51796617 - 51889042 (-)
Description
sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D Gene [Source:MGI (curated);Acc:Sema4d-001]
RefSeq_dna
NM_013660 
RefSeq_peptide
NP_038688.2 
UniGene
Mm.404751 Mm.420142 Mm.33903 
MGI
MGI:109244 
Uniprot/SWISSPROT
O09126 
Uniprot/SPTREMBL
Q6GTM9 Q8BJC1 
Human Ortholog
ENSG00000187764 (SEMA4D)
Omim not available
UniTrap UNI25269
Vector Insertion
Chr 13: 51888865 - 51889014
Public Clones not available
Private Clones OST189778 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35023
Vector Insertion
Chr 13: 51858620 - 51889014
Public Clones IST14475E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI732
Vector Insertion
Chr 13: 51830133 - 51858620
Public Clones DA0182 (sanger) D107C03 (ggtc) D105D03 (ggtc) IST14623H1 (tigm) IST14858G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25297
Vector Insertion
Chr 13: 51820912 - 51829875
Public Clones (sanger) D133F08 (ggtc) IST14548B2 (tigm)
Private Clones OST188621 (lexicon) OST136704 (lexicon) OST98932 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27353
Vector Insertion
Chr 13: 51796618 - 51798901
Public Clones not available
Private Clones OST62177 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110039
Sequence
GACCCAGGCTTCCCCTTTGCTGGCTGCCCAGCACCTCACTTCTGGTGCAGTGAACAAGCCCCGCAGGAACTGGATAGAGAGGTCATCTGCTTGGGGCCCT

AAGGAGTTTGTATTTAGTGCCTGTCTGAAACCCAAGCGCCCCGTGAGGGTGGAGGACCCAGGGGCTTGACTCTTAGTCTCTCATTACTTTCAGAGATGTC

TTCCTGAAGCTTCCATTCTAAAGGTGCCAGGAACAACCCCAGAGACTCACGGCACAG - UNI25297 - GTCAGACGGGAACACCGGCAGCCTTGGCA

TGACGTCGTGAAGGTGGCCATTGCTAACCTGACATGTGGGGACTCAGGAACCCCACCCCTTATGGGCTCCAGTCTGTGCTGCTGGCCCCAGCTCTGGGGC

TCTAAGAGGTCCTTGCTGCTACCCCACAGCAGCCTGCTGCCATCCATGTGTGCCCGTTGCTGAAGGCCTCGGTGGCCCCTGCCCATGAGGATGTGTGCCC

CCGTTAGGGGGCTGTTCTTGGCCCTGGTGGTAGTGTTGAGAACCGCGGTGGCATTTGCACCTGTGCCTCGGCTCACCTGGGAACATGGAG AGGTAGGTC

TGGTGCAGTTTCACAAGCCAGGCATCTTTAACTACTCGGCCTTGCTGATGAGTGAGGACAAAGACACTCTGTATGTAGGCGCCCGGGAAGCAGTCTTTGC

AGTGAATGCGCTGAACATCTCTGAGAAGCAACATGAG GTATATTGGAAGGTCTCTGAAGACAAAAAATCCAAGTGTGCAGAGAAGGGGAAATCAAAGCA

G ACGGAATGCCTAAACTACATTCGAGTACTACAGCCACTAAGCAGCACTTCCCTCTATGTGTGTGGGACCAATGCGTTCCAGCCCACCTGTGACCACCT

G AACTTGACATCCTTCAAGTTTCTGGGGAAAAGTGAAGATGGCAAAGGAAGATGCCCCTTCGACCCCGCCCACAGCTACACATCAGTCATGGTTG GGG

GCGAGCTCTACTCTGGGACGTCCTATAATTTCTTGGGCAGTGAACCCATCATCTCTCGAAACTCTTCCCACAGTCCCTTGAGGACGGAGTATGCCATCCC

GTGGCTGAACG AGCCTAGCTTCGTCTTTGCTGACGTGATCCAGAAAAGCCCAGATGGTCCGGAGGGTGAAGATGACAAGGTCTACTTCTTTTTTACGGA

GGTATCCGTGGAGTACGAATTCGTCTTCAAGTTGATGATCCCGCGAGTTGCCAGGGTGTGCAAG GGCGACCAGGGCGGCCTGCGGACTTTGCAAAAAAA

GTGGACCTCCTTCCTAAAGGCCAGGCTGATCTGCTCCAAGCCAGACAGTGGCCTGGTCTTCAACATACTTCAGGATGTGTTTGTGCTGAGGGCCCCGGGC

CTCAAGGAGCCTGTGTTCTATGCGGTCTTCACCCCACAGCT GAACAATGTGGGTCTGTCAGCGGTGTGCGCCTACACACTGGCCACGGTGGAGGCAGTC

TTCTCCCGTGGAAAGTACATGCAGAGTGCCACAGTGGAGCAGTCTCACACCAAGTGGGTGCGCTACAATGGCCCAGTGCCCACTCCCCGACCTGGAGCG 

TGTATCGACAGTGAGGCCCGGGCAGCCAACTACACCAGCTCCTTGAATCTCCCAGACAAAACACTGCAGTTTGTAAAAGACCACCCTTTGATGGATGACT

CAGTGACCCCGATAGACAACAGACCCAAGCTGATCAAAAAAGATGTAAACTACACCCAGATAGTGGTAGACAGGACCCAGGCCCTGGATGGGACTTTCTA

CGACGTCATGTTCATCAGCACAG ACCGGGGAGCTCTGCATAAAGCAGTCATCCTCACAAAAGAGGTGCATGTCATCGAGGAGACCCAACTCTTCCGGGA

CTCTGAACCGGTCCTAACTCTGCTGCTATCGTCAAAGAAG GGGAGGAAGTTTGTCTATGCAGGCTCCAACTCTGGAGTGGTCCAAGCGCCCCTGGCATT

CTGCGAAAAGCACGGTAGCTGTGAAGACTGTGTGTTAGCACGGGACCCCTACTGTGCCTGGAGCCCAGCCATCAAGGCCTGTGTTACCCTGCACCAGGAA

GAGGCCTCCAGCAG GGGCTGGATTCAGGACATGAGCGGTGACACATCCTCATGCCTGG - UNI27353 - ATAAGAGTAAAGAAAGTTTCAACCAGC

ATTTTTTCAAGCACGGCGGCACAGCGGAACTCAAATGTTTCCAAAAGTCCAACCTAGCCCGGGTGGTATGGAAGTTCCAGAATGGCGAGTTGAAGGCCGC

AAGTCCCAAGTACGGCTTTGTGGGCAGGAAGCACCTGCTCATCTTCAACCTGTCGGACGGAGACAGCGGCGTGTACCAGTGCCTGTCAGAGGAAAGGGTG

AGGAATAAAACGGTCTCCCAGCTGCTGGCCAAGCACGTTCTGGAAGTGAAGATGGTACCTCGGACCCCCCCCTCACCTACCTCAGAGGATGCTCAGACAG

AAGGTAGTAAGATCACATCCAAAATGCCGGTTGCATCTACCCAGGGGTCCTCTCCCCCTACCCCGGCTCTGTGGGCAACCTCCCCCAGAGCCGCCACCCT

ACCTCCCAAGTCCTCCTCCGGCACATCCTGTGAACCAAAGATGGTCATCAACACGGTCCCCCAGCTCCACTCAGAGAAGACGGTGTATCTCAAGTCCAGT

GACAACCGCCTGCTCATGTCTCTCCTCCTCTTCATCTTTGTCCTCTTCCTCTGCCTCTTTTCCTACAACTGCTACAAGGGCTACCTGCCCGGACAGTGCT

TAAAATTCCGCTCAGCCCTGCTGCTTGGAAAGAAAACACCCAAGTCAGACTTCTCTGACCTGGAGCAGAGTGTGAAGGAGACACTGGTCGAGCCTGGGAG

CTTCTCCCAGCAGAACGGCGACCACCCCAAGCCAGCCCTGGATACGGGCTATGAAACGGAGCAGGACACCATCACCAGCAAAGTCCCCACGGATCGTGAG

GACTCGCAACGGATCGATGAACTCTCTGCCCGGGACAAACCGTTTGATGTCAAGTGTGAACTGAAGTTTGCAGATTCGGATGCTGACGGGGACTGAGGCC

AGCGTGTCCCAGCCCATGCCCCTCTGTCTTCGTGGAGAGTGTTGTGTTGAGCCCATTCAGTAGCCGAGTCTTGTCACTCTGTGCCAGCCTCAGTCCTGTG

TCCCTTTTTCTCTTGGGTTGAGCCTGTGGCTCATCCCCTTTGTCCTTTTGGGAAGCAAGTATCTATTCCAGTCTCAAGTCCTGCAGTTGCTGGAGCGCTT

ACGCACCTGAGCCCTTTGTGTCCTGGGGGAGAGATGGCCACCTCCGTGGGCTGCGAAGAGCCACCCCTTCCTCTTCCGATTCTCCTAGCAGCCACTCAGA

GATAATTTAATTCCAGATTGGAAACGCCCTTTTAGTTTATCAGATTGGTAACTTACATCCTGCTGCCCAGATGGCACGGACAGTTTTCTTTCACTTAATT

ATTATTTTTTTTTTAAGGATTTTCGCTCCTATTGTGTTGATGTCTTAGGTCATTTTCTTTTTTTCTTTCTCTTTTTTTATTACCAGAGGAGATGTTTTAA

TATTCATGAGAAGAGGAACATTTTCTAGATTTTTTTGTTGTTATATATTGAGATATAAAATATGGCTATGTTGCTTAAGATTCTCAGGGATAGACTTATT

TTTGTTAACTTCATTCTTTCCTGCTGTTAGGAACATAGGCCTAAAATTGTCTCTTGAGTTTGCTCACCCTTTTGTTTTGGTAGGGTTTTTTTGTTGTTGC

TGTTATTGTTTCTAGTTTTTAATCTTATTCATTTTGAAGGATTTTTCTTTCTGAACTTTTTAAATTTTTATATTTTCCTGCCATACATCTACAAAGTGGG

TTTTGAGTGAGGGCAGGTGGCCCAGTGGCTTTGGGTGGCGACTGAGCTGGTCCCACGAGGGGAGGAGGGTTTATATACCCCATGACCCTGCGGCTTCTTG

GCGCCTCCTGCCCATGAGGATCACATCCTGTCTCTCCTTGCTTCCATCTCTCATCACTGCCCTTGGACTTCCGCCTTGACTGTCCATGAAAGACAGAAAT

GGGTTGGGTAGTTGGGCTCCCAACCTCGGATGGTGACCGCAACATCCCGTGTGGGCGGCCGGCCGCTCCTGCAGCCCGACTCTCCTGCCAGTGTCTTTCA

GGATGTCAACGGGTGGTACGATTCTGGCATTTGTTTCTCGCTCACCGTGTGTGGAACACTCATTCCATGTAGAGGGTGACGAACTCTGGATTCCCCCCCA

CCCCCACCCCGTGCCGTGTAGACACTCATCTTCTGCATGACATGATCTACCATTCGGTGTAAACATTTGTGTTTATAAGATTTACTTTGTTTTTATTTTT

CTACTTGGAACTGTACACATTTGAAAAGTACCCAAATAAACCAGAAGCTTTATCG
Translation
 - UNI25297 - MRMCAPVRGLFLALVVVLRTAVAFAPVPRLTWEHGE EVGLVQFHKPGIFNYSALLMSEDKDTLYVGAREAVFAVNALNISEKQHE

 VYWKVSEDKKSKCAEKGKSKQ TECLNYIRVLQPLSSTSLYVCGTNAFQPTCDHL NLTSFKFLGKSEDGKGRCPFDPAHSYTSVMVG GGELYSGTSY

NFLGSEPIISRNSSHSPLRTEYAIPWLNE EPSFVFADVIQKSPDGPEGEDDKVYFFFTEVSVEYEFVFKLMIPRVARVCK GDQGGLRTLQKKWTSFLK

ARLICSKPDSGLVFNILQDVFVLRAPGLKEPVFYAVFTPQL LNNVGLSAVCAYTLATVEAVFSRGKYMQSATVEQSHTKWVRYNGPVPTPRPGA CIDS

EARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPKLIKKDVNYTQIVVDRTQALDGTFYDVMFISTD DRGALHKAVILTKEVHVIEETQLFRDSE

PVLTLLLSSKK GRKFVYAGSNSGVVQAPLAFCEKHGSCEDCVLARDPYCAWSPAIKACVTLHQEEASSR RGWIQDMSGDTSSCLD - UNI27353 -

 DKSKESFNQHFFKHGGTAELKCFQKSNLARVVWKFQNGELKAASPKYGFVGRKHLLIFNLSDGDSGVYQCLSEERVRNKTVSQLLAKHVLEVKMVPRTP

PSPTSEDAQTEGSKITSKMPVASTQGSSPPTPALWATSPRAATLPPKSSSGTSCEPKMVINTVPQLHSEKTVYLKSSDNRLLMSLLLFIFVLFLCLFSYN

CYKGYLPGQCLKFRSALLLGKKTPKSDFSDLEQSVKETLVEPGSFSQQNGDHPKPALDTGYETEQDTITSKVPTDREDSQRIDELSARDKPFDVKCELKF

ADSDADGD
Transcript ENSMUST00000110040
Sequence
GGCCTCCGCTCCCTCTCGCGCCGCAGCATCTCCGCGCGTCTCCCGGCCTCCCCGACTCAAGCTCCTGGCGCCGTTCGCCTCTGTCGTCGCTGCCACCAAC

GCCGCCGCCATTCTTGGCGCGGAGCTGGCCTGGCCAGCCCCCGCCGAGAGCCTCCGCGGGTCGGACGCGCGCTCCAG - UNI25269 - ACCCTGGTA

ACACCACAGGAACACAGCCAAGTCCTGAATACCGACATGTCTGACAGTGCTGATCCCTAG - UNI732 - AGATGTCTTCCTGAAGCTTCCATTCTAA

AGGTGCCAGGAACAACCCCAGAGACTCACGGCACAG - UNI25297 - GTCAGACGGGAACACCGGCAGCCTTGGCATGACGTCGTGAAGGTGGCCAT

TGCTAACCTGACATGTGGGGACTCAGGAACCCCACCCCTTATGGGCTCCAGTCTGTGCTGCTGGCCCCAGCTCTGGGGCTCTAAGAGGTCCTTGCTGCTA

CCCCACAGCAGCCTGCTGCCATCCATGTGTGCCCGTTGCTGAAGGCCTCGGTGGCCCCTGCCCATGAGGATGTGTGCCCCCGTTAGGGGGCTGTTCTTGG

CCCTGGTGGTAGTGTTGAGAACCGCGGTGGCATTTGCACCTGTGCCTCGGCTCACCTGGGAACATGGAG AGGTAGGTCTGGTGCAGTTTCACAAGCCAG

GCATCTTTAACTACTCGGCCTTGCTGATGAGTGAGGACAAAGACACTCTGTATGTAGGCGCCCGGGAAGCAGTCTTTGCAGTGAATGCGCTGAACATCTC

TGAGAAGCAACATGAG GTATATTGGAAGGTCTCTGAAGACAAAAAATCCAAGTGTGCAGAGAAGGGGAAATCAAAGCAG ACGGAATGCCTAAACTACA

TTCGAGTACTACAGCCACTAAGCAGCACTTCCCTCTATGTGTGTGGGACCAATGCGTTCCAGCCCACCTGTGACCACCTG AACTTGACATCCTTCAAGT

TTCTGGGGAAAAGTGAAGATGGCAAAGGAAGATGCCCCTTCGACCCCGCCCACAGCTACACATCAGTCATGGTTG GGGGCGAGCTCTACTCTGGGACGT

CCTATAATTTCTTGGGCAGTGAACCCATCATCTCTCGAAACTCTTCCCACAGTCCCTTGAGGACGGAGTATGCCATCCCGTGGCTGAACG AGCCTAGCT

TCGTCTTTGCTGACGTGATCCAGAAAAGCCCAGATGGTCCGGAGGGTGAAGATGACAAGGTCTACTTCTTTTTTACGGAGGTATCCGTGGAGTACGAATT

CGTCTTCAAGTTGATGATCCCGCGAGTTGCCAGGGTGTGCAAG GGCGACCAGGGCGGCCTGCGGACTTTGCAAAAAAAGTGGACCTCCTTCCTAAAGGC

CAGGCTGATCTGCTCCAAGCCAGACAGTGGCCTGGTCTTCAACATACTTCAGGATGTGTTTGTGCTGAGGGCCCCGGGCCTCAAGGAGCCTGTGTTCTAT

GCGGTCTTCACCCCACAGCT GAACAATGTGGGTCTGTCAGCGGTGTGCGCCTACACACTGGCCACGGTGGAGGCAGTCTTCTCCCGTGGAAAGTACATG

CAGAGTGCCACAGTGGAGCAGTCTCACACCAAGTGGGTGCGCTACAATGGCCCAGTGCCCACTCCCCGACCTGGAGCG TGTATCGACAGTGAGGCCCGG

GCAGCCAACTACACCAGCTCCTTGAATCTCCCAGACAAAACACTGCAGTTTGTAAAAGACCACCCTTTGATGGATGACTCAGTGACCCCGATAGACAACA

GACCCAAGCTGATCAAAAAAGATGTAAACTACACCCAGATAGTGGTAGACAGGACCCAGGCCCTGGATGGGACTTTCTACGACGTCATGTTCATCAGCAC

AG ACCGGGGAGCTCTGCATAAAGCAGTCATCCTCACAAAAGAGGTGCATGTCATCGAGGAGACCCAACTCTTCCGGGACTCTGAACCGGTCCTAACTCT

GCTGCTATCGTCAAAGAAG GGGAGGAAGTTTGTCTATGCAGGCTCCAACTCTGGAGTGGTCCAAGCGCCCCTGGCATTCTGCGAAAAGCACGGTAGCTG

TGAAGACTGTGTGTTAGCACGGGACCCCTACTGTGCCTGGAGCCCAGCCATCAAGGCCTGTGTTACCCTGCACCAGGAAGAGGCCTCCAGCAG GGGCTG

GATTCAGGACATGAGCGGTGACACATCCTCATGCCTGG - UNI27353 - ATAAGAGTAAAGAAAGTTTCAACCAGCATTTTTTCAAGCACGGCGGCA

CAGCGGAACTCAAATGTTTCCAAAAGTCCAACCTAGCCCGGGTGGTATGGAAGTTCCAGAATGGCGAGTTGAAGGCCGCAAGTCCCAAGTACGGCTTTGT

GGGCAGGAAGCACCTGCTCATCTTCAACCTGTCGGACGGAGACAGCGGCGTGTACCAGTGCCTGTCAGAGGAAAGGGTGAGGAATAAAACGGTCTCCCAG

CTGCTGGCCAAGCACGTTCTGGAAGTGAAGATGGTACCTCGGACCCCCCCCTCACCTACCTCAGAGGATGCTCAGACAGAAGGTAGTAAGATCACATCCA

AAATGCCGGTTGCATCTACCCAGGGGTCCTCTCCCCCTACCCCGGCTCTGTGGGCAACCTCCCCCAGAGCCGCCACCCTACCTCCCAAGTCCTCCTCCGG

CACATCCTGTGAACCAAAGATGGTCATCAACACGGTCCCCCAGCTCCACTCAGAGAAGACGGTGTATCTCAAGTCCAGTGACAACCGCCTGCTCATGTCT

CTCCTCCTCTTCATCTTTGTCCTCTTCCTCTGCCTCTTTTCCTACAACTGCTACAAGGGCTACCTGCCCGGACAGTGCTTAAAATTCCGCTCAGCCCTGC

TGCTTGGAAAGAAAACACCCAAGTCAGACTTCTCTGACCTGGAGCAGAGTGTGAAGGAGACACTGGTCGAGCCTGGGAGCTTCTCCCAGCAGAACGGCGA

CCACCCCAAGCCAGCCCTGGATACGGGCTATGAAACGGAGCAGGACACCATCACCAGCAAAGTCCCCACGGATCGTGAGGACTCGCAACGGATCGATGAA

CTCTCTGCCCGGGACAAACCGTTTGATGTCAAGTGTGAACTGAAGTTTGCAGATTCGGATGCTGACGGGGACTGAGGCCAGCGTGTCCCAGCCCATGCCC

CTCTGTCTTCGTGGAGAGTGTTGTGTTGAGCCCATTCAGTAGCCGAGTCTTGTCACTCTGTGCCAGCCTCAGTCCTGTGTCCCTTTTTCTCTTGGGTTGA

GCCTGTGGCTCATCCCCTTTGTCCTTTTGGGAAGCAAGTATCTATTCCAGTCTCAAGTCCTGCAGTTGCTGGAGCGCTTACGCACCTGAGCCCTTTGTGT

CCTGGGGGAGAGATGGCCACCTCCGTGGGCTGCGAAGAGCCACCCCTTCCTCTTCCGATTCTCCTAGCAGCCACTCAGAGATAATTTAATTCCAGATTGG

AAACGCCCTTTTAGTTTATCAGATTGGTAACTTACATCCTGCTGCCCAGATGGCACGGACAGTTTTCTTTCACTTAATTATTATTTTTTTTTTAAGGATT

TTCGCTCCTATTGTGTTGATGTCTTAGGTCATTTTCTTTTTTTCTTTCTCTTTTTTTATTACCAGAGGAGATGTTTTAATATTCATGAGAAGAGGAACAT

TTTCTAGATTTTTTTGTTGTTATATATTGAGATATAAAATATGGCTATGTTGCTTAAGATTCTCAGGGATAGACTTATTTTTGTTAACTTCATTCTTTCC

TGCTGTTAGGAACATAGGCCTAAAATTGTCTCTTGAGTTTGCTCACCCTTTTGTTTTGGTAGGGTTTTTTTGTTGTTGCTGTTATTGTTTCTAGTTTTTA

ATCTTATTCATTTTGAAGGATTTTTCTTTCTGAACTTTTTAAATTTTTATATTTTCCTGCCATACATCTACAAAGTGGGTTTTGAGTGAGGGCAGGTGGC

CCAGTGGCTTTGGGTGGCGACTGAGCTGGTCCCACGAGGGGAGGAGGGTTTATATACCCCATGACCCTGCGGCTTCTTGGCGCCTCCTGCCCATGAGGAT

CACATCCTGTCTCTCCTTGCTTCCATCTCTCATCACTGCCCTTGGACTTCCGCCTTGACTGTCCATGAAAGACAGAAATGGGTTGGGTAGTTGGGCTCCC

AACCTCGGATGGTGACCGCAACATCCCGTGTGGGCGGCCGGCCGCTCCTGCAGCCCGACTCTCCTGCCAGTGTCTTTCAGGATGTCAACGGGTGGTACGA

TTCTGGCATTTGTTTCTCGCTCACCGTGTGTGGAACACTCATTCCATGTAGAGGGTGACGAACTCTGGATTCCCCCCCACCCCCACCCCGTGCCGTGTAG

ACACTCATCTTCTGCATGACATGATCTACCATTCGGTGTAAACATTTGTGTTTATAAGATTTACTTTGTTTTTATTTTTCTACTTGGAACTGTACACATT

TGAAAAGTACCCAAATAAACCAGAAGCTTTATCG
Translation
 - UNI25269 -  - UNI732 -  - UNI25297 - MRMCAPVRGLFLALVVVLRTAVAFAPVPRLTWEHGE EVGLVQFHKPGIFNYSALLMSED

KDTLYVGAREAVFAVNALNISEKQHE VYWKVSEDKKSKCAEKGKSKQ TECLNYIRVLQPLSSTSLYVCGTNAFQPTCDHL NLTSFKFLGKSEDGKGR

CPFDPAHSYTSVMVG GGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNE EPSFVFADVIQKSPDGPEGEDDKVYFFFTEVSVEYEFVFKLMIP

RVARVCK GDQGGLRTLQKKWTSFLKARLICSKPDSGLVFNILQDVFVLRAPGLKEPVFYAVFTPQL LNNVGLSAVCAYTLATVEAVFSRGKYMQSATV

EQSHTKWVRYNGPVPTPRPGA CIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPKLIKKDVNYTQIVVDRTQALDGTFYDVMFISTD DR

GALHKAVILTKEVHVIEETQLFRDSEPVLTLLLSSKK GRKFVYAGSNSGVVQAPLAFCEKHGSCEDCVLARDPYCAWSPAIKACVTLHQEEASSR RGW

IQDMSGDTSSCLD - UNI27353 - DKSKESFNQHFFKHGGTAELKCFQKSNLARVVWKFQNGELKAASPKYGFVGRKHLLIFNLSDGDSGVYQCLSE

ERVRNKTVSQLLAKHVLEVKMVPRTPPSPTSEDAQTEGSKITSKMPVASTQGSSPPTPALWATSPRAATLPPKSSSGTSCEPKMVINTVPQLHSEKTVYL

KSSDNRLLMSLLLFIFVLFLCLFSYNCYKGYLPGQCLKFRSALLLGKKTPKSDFSDLEQSVKETLVEPGSFSQQNGDHPKPALDTGYETEQDTITSKVPT

DREDSQRIDELSARDKPFDVKCELKFADSDADGD
Transcript ENSMUST00000021900
Sequence
CTCCGCGCGTCTCCCGGCCTCCCCGACTCAAGCTCCTGGCGCCGTTCGCCTCTGTCGTCGCTGCCACCAACGCCGCCGCCATTCTTGGCGCGGAGCTGGC

CTGGCCAGCCCCCGCCGAGAGCCTCCGCGGGTCGGACGCGCGCTCCAG - UNI25269 - ACCCTGGTAACACCACAGGAACACAGCCAAGTCCTGAA

TACCGACATGTCTGACAGTGCTGATCCCTAG - UNI732 - - UNI25297 - GTCAGACGGGAACACCGGCAGCCTTGGCATGACGTCGTGAAGGT

GGCCATTGCTAACCTGACATGTGGGGACTCAGGAACCCCACCCCTTATGGGCTCCAGTCTGTGCTGCTGGCCCCAGCTCTGGGGCTCTAAGAGGTCCTTG

CTGCTACCCCACAGCAGCCTGCTGCCATCCATGTGTGCCCGTTGCTGAAGGCCTCGGTGGCCCCTGCCCATGAGGATGTGTGCCCCCGTTAGGGGGCTGT

TCTTGGCCCTGGTGGTAGTGTTGAGAACCGCGGTGGCATTTGCACCTGTGCCTCGGCTCACCTGGGAACATGGAG AGGTAGGTCTGGTGCAGTTTCACA

AGCCAGGCATCTTTAACTACTCGGCCTTGCTGATGAGTGAGGACAAAGACACTCTGTATGTAGGCGCCCGGGAAGCAGTCTTTGCAGTGAATGCGCTGAA

CATCTCTGAGAAGCAACATGAG GTATATTGGAAGGTCTCTGAAGACAAAAAATCCAAGTGTGCAGAGAAGGGGAAATCAAAGCAG ACGGAATGCCTAA

ACTACATTCGAGTACTACAGCCACTAAGCAGCACTTCCCTCTATGTGTGTGGGACCAATGCGTTCCAGCCCACCTGTGACCACCTG AACTTGACATCCT

TCAAGTTTCTGGGGAAAAGTGAAGATGGCAAAGGAAGATGCCCCTTCGACCCCGCCCACAGCTACACATCAGTCATGGTTG GGGGCGAGCTCTACTCTG

GGACGTCCTATAATTTCTTGGGCAGTGAACCCATCATCTCTCGAAACTCTTCCCACAGTCCCTTGAGGACGGAGTATGCCATCCCGTGGCTGAACG AGC

CTAGCTTCGTCTTTGCTGACGTGATCCAGAAAAGCCCAGATGGTCCGGAGGGTGAAGATGACAAGGTCTACTTCTTTTTTACGGAGGTATCCGTGGAGTA

CGAATTCGTCTTCAAGTTGATGATCCCGCGAGTTGCCAGGGTGTGCAAG GGCGACCAGGGCGGCCTGCGGACTTTGCAAAAAAAGTGGACCTCCTTCCT

AAAGGCCAGGCTGATCTGCTCCAAGCCAGACAGTGGCCTGGTCTTCAACATACTTCAGGATGTGTTTGTGCTGAGGGCCCCGGGCCTCAAGGAGCCTGTG

TTCTATGCGGTCTTCACCCCACAGCT GAACAATGTGGGTCTGTCAGCGGTGTGCGCCTACACACTGGCCACGGTGGAGGCAGTCTTCTCCCGTGGAAAG

TACATGCAGAGTGCCACAGTGGAGCAGTCTCACACCAAGTGGGTGCGCTACAATGGCCCAGTGCCCACTCCCCGACCTGGAGCG TGTATCGACAGTGAG

GCCCGGGCAGCCAACTACACCAGCTCCTTGAATCTCCCAGACAAAACACTGCAGTTTGTAAAAGACCACCCTTTGATGGATGACTCAGTGACCCCGATAG

ACAACAGACCCAAGCTGATCAAAAAAGATGTAAACTACACCCAGATAGTGGTAGACAGGACCCAGGCCCTGGATGGGACTTTCTACGACGTCATGTTCAT

CAGCACAG ACCGGGGAGCTCTGCATAAAGCAGTCATCCTCACAAAAGAGGTGCATGTCATCGAGGAGACCCAACTCTTCCGGGACTCTGAACCGGTCCT

AACTCTGCTGCTATCGTCAAAGAAG GGGAGGAAGTTTGTCTATGCAGGCTCCAACTCTGGAGTGGTCCAAGCGCCCCTGGCATTCTGCGAAAAGCACGG

TAGCTGTGAAGACTGTGTGTTAGCACGGGACCCCTACTGTGCCTGGAGCCCAGCCATCAAGGCCTGTGTTACCCTGCACCAGGAAGAGGCCTCCAGCAG 

GGGCTGGATTCAGGACATGAGCGGTGACACATCCTCATGCCTGG - UNI27353 - ATAAGAGTAAAGAAAGTTTCAACCAGCATTTTTTCAAGCACG

GCGGCACAGCGGAACTCAAATGTTTCCAAAAGTCCAACCTAGCCCGGGTGGTATGGAAGTTCCAGAATGGCGAGTTGAAGGCCGCAAGTCCCAAGTACGG

CTTTGTGGGCAGGAAGCACCTGCTCATCTTCAACCTGTCGGACGGAGACAGCGGCGTGTACCAGTGCCTGTCAGAGGAAAGGGTGAGGAATAAAACGGTC

TCCCAGCTGCTGGCCAAGCACGTTCTGGAAGTGAAGATGGTACCTCGGACCCCCCCCTCACCTACCTCAGAGGATGCTCAGACAGAAGGTAGTAAGATCA

CATCCAAAATGCCGGTTGCATCTACCCAGGGGTCCTCTCCCCCTACCCCGGCTCTGTGGGCAACCTCCCCCAGAGCCGCCACCCTACCTCCCAAGTCCTC

CTCCGGCACATCCTGTGAACCAAAGATGGTCATCAACACGGTCCCCCAGCTCCACTCAGAGAAGACGGTGTATCTCAAGTCCAGTGACAACCGCCTGCTC

ATGTCTCTCCTCCTCTTCATCTTTGTCCTCTTCCTCTGCCTCTTTTCCTACAACTGCTACAAGGGCTACCTGCCCGGACAGTGCTTAAAATTCCGCTCAG

CCCTGCTGCTTGGAAAGAAAACACCCAAGTCAGACTTCTCTGACCTGGAGCAGAGTGTGAAGGAGACACTGGTCGAGCCTGGGAGCTTCTCCCAGCAGAA

CGGCGACCACCCCAAGCCAGCCCTGGATACGGGCTATGAAACGGAGCAGGACACCATCACCAGCAAAGTCCCCACGGATCGTGAGGACTCGCAACGGATC

GATGAACTCTCTGCCCGGGACAAACCGTTTGATGTCAAGTGTGAACTGAAGTTTGCAGATTCGGATGCTGACGGGGACTGAGGCCAGCGTGTCCCAGCCC

ATGCCCCTCTGTCTTCGTGGAGAGTGTTGTGTTGAGCCCATTCAGTAGCCGAGTCTTGTCACTCTGTGCCAGCCTCAGTCCTGTGTCCCTTTTTCTCTTG

GGTTGAGCCTGTGGCTCATCCCCTTTGTCCTTTTGGGAAGCAAGTATCTATTCCAGTCTCAAGTCCTGCAGTTGCTGGAGCGCTTACGCACCTGAGCCCT

TTGTGTCCTGGGGGAGAGATGGCCACCTCCGTGGGCTGCGAAGAGCCACCCCTTCCTCTTCCGATTCTCCTAGCAGCCACTCAGAGATAATTTAATTCCA

GATTGGAAACGCCCTTTTAGTTTATCAGATTGGTAACTTACATCCTGCTGCCCAGATGGCACGGACAGTTTTCTTTCACTTAATTATTATTTTTTTTTTA

AGGATTTTCGCTCCTATTGTGTTGATGTCTTAGGTCATTTTCTTTTTTTCTTTCTCTTTTTTTATTACCAGAGGAGATGTTTTAATATTCATGAGAAGAG

GAACATTTTCTAGATTTTTTTGTTGTTATATATTGAGATATAAAATATGGCTATGTTGCTTAAGATTCTCAGGGATAGACTTATTTTTGTTAACTTCATT

CTTTCCTGCTGTTAGGAACATAGGCCTAAAATTGTCTCTTGAGTTTGCTCACCCTTTTGTTTTGGTAGGGTTTTTTTGTTGTTGCTGTTATTGTTTCTAG

TTTTTAATCTTATTCATTTTGAAGGATTTTTCTTTCTGAACTTTTTAAATTTTTATATTTTCCTGCCATACATCTACAAAGTGGGTTTTGAGTGAGGGCA

GGTGGCCCAGTGGCTTTGGGTGGCGACTGAGCTGGTCCCACGAGGGGAGGAGGGTTTATATACCCCATGACCCTGCGGCTTCTTGGCGCCTCCTGCCCAT

GAGGATCACATCCTGTCTCTCCTTGCTTCCATCTCTCATCACTGCCCTTGGACTTCCGCCTTGACTGTCCATGAAAGACAGAAATGGGTTGGGTAGTTGG

GCTCCCAACCTCGGATGGTGACCGCAACATCCCGTGTGGGCGGCCGGCCGCTCCTGCAGCCCGACTCTCCTGCCAGTGTCTTTCAGGATGTCAACGGGTG

GTACGATTCTGGCATTTGTTTCTCGCTCACCGTGTGTGGAACACTCATTCCATGTAGAGGGTGACGAACTCTGGATTCCCCCCCACCCCCACCCCGTGCC

GTGTAGACACTCATCTTCTGCATGACATGATCTACCATTCGGTGTAAACATTTGTGTTTATAAGATTTACTTTGTTTTTATTTTTCTACTTGGAACTGTA

CACATTTGAAAAGTACCCAAATAAACCAGAAGCTTTATCGTT
Translation
 - UNI25269 -  - UNI732 - - UNI25297 - MRMCAPVRGLFLALVVVLRTAVAFAPVPRLTWEHGE EVGLVQFHKPGIFNYSALLMSEDK

DTLYVGAREAVFAVNALNISEKQHE VYWKVSEDKKSKCAEKGKSKQ TECLNYIRVLQPLSSTSLYVCGTNAFQPTCDHL NLTSFKFLGKSEDGKGRC

PFDPAHSYTSVMVG GGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNE EPSFVFADVIQKSPDGPEGEDDKVYFFFTEVSVEYEFVFKLMIPR

VARVCK GDQGGLRTLQKKWTSFLKARLICSKPDSGLVFNILQDVFVLRAPGLKEPVFYAVFTPQL LNNVGLSAVCAYTLATVEAVFSRGKYMQSATVE

QSHTKWVRYNGPVPTPRPGA CIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPKLIKKDVNYTQIVVDRTQALDGTFYDVMFISTD DRG

ALHKAVILTKEVHVIEETQLFRDSEPVLTLLLSSKK GRKFVYAGSNSGVVQAPLAFCEKHGSCEDCVLARDPYCAWSPAIKACVTLHQEEASSR RGWI

QDMSGDTSSCLD - UNI27353 - DKSKESFNQHFFKHGGTAELKCFQKSNLARVVWKFQNGELKAASPKYGFVGRKHLLIFNLSDGDSGVYQCLSEE

RVRNKTVSQLLAKHVLEVKMVPRTPPSPTSEDAQTEGSKITSKMPVASTQGSSPPTPALWATSPRAATLPPKSSSGTSCEPKMVINTVPQLHSEKTVYLK

SSDNRLLMSLLLFIFVLFLCLFSYNCYKGYLPGQCLKFRSALLLGKKTPKSDFSDLEQSVKETLVEPGSFSQQNGDHPKPALDTGYETEQDTITSKVPTD

REDSQRIDELSARDKPFDVKCELKFADSDADGD

For any suggestions or comments, please send an email to unitrap@crg.es