Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021458 (2010111I01Rik)
Chromosomal location
Chr 13: 63116294 - 63403592 (+)
Description
RIKEN cDNA 2010111I01 gene Gene [Source:MGI Symbol;Acc:MGI:1919311]
RefSeq_dna
NM_028079 
RefSeq_peptide
NP_082355.1 
UniGene
Mm.188105 Mm.437509 
MGI
MGI:1919311 
Uniprot/SWISSPROT
Q8BXQ6 
Uniprot/SPTREMBL
A0JLQ8 Q3TIP2 Q3UQZ7 Q80VC3 
Human Ortholog
ENSG00000148120 (C9orf3)
Omim not available
UniTrap UNI36200
Vector Insertion
Chr 13: 63311476 - 63341395
Public Clones (sanger) IST11601E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11349
Vector Insertion
Chr 13: 63341465 - 63341565
Public Clones P110C06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14617
Vector Insertion
Chr 13: 63341641 - 63383449
Public Clones (sanger) E082E11 (ggtc) D026C09 (ggtc) D168F06 (ggtc) E082F12 (ggtc)
D033C02 (ggtc) E023E10 (ggtc) P133G09 (ggtc) 5SE320H04 (ggtc) E082F11 (ggtc)
E023E09 (ggtc) D134F03 (ggtc) 3SE320H04 (ggtc) FHCRC-GT-S5-2B1 (fhcrc) IST14412C1 (tigm)
IST11224B1 (tigm) IST10899C1 (tigm)
Private Clones OST465109 (lexicon) OST440553 (lexicon) OST437104 (lexicon) OST401868 (lexicon)
OST392672 (lexicon) OST364605 (lexicon) OST352400 (lexicon) OST351653 (lexicon)
OST304414 (lexicon) OST283777 (lexicon) OST282840 (lexicon) OST262076 (lexicon)
OST237821 (lexicon) OST230812 (lexicon) OST179701 (lexicon) OST146124 (lexicon)
OST133314 (lexicon) OST119425 (lexicon) OST108639 (lexicon) OST94689 (lexicon)
OST66105 (lexicon) OST61500 (lexicon) OST49247 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2350
Vector Insertion
Chr 13: 63383567 - 63398165
Public Clones (sanger) AD0611 (sanger) AJ0578 (sanger) D145A06 (ggtc) Q015F01 (ggtc)
E028H04 (ggtc) M119B05 (ggtc) IST14384C7 (tigm) IST14885H11 (tigm)
IST11557F11 (tigm)
Private Clones OST429645 (lexicon) OST386378 (lexicon) OST357111 (lexicon) OST288756 (lexicon)
OST279737 (lexicon) OST248325 (lexicon) OST203049 (lexicon) OST170841 (lexicon)
OST147205 (lexicon) OST70918 (lexicon) OST61866 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17382
Vector Insertion
Chr 13: 63398253 - 63400019
Public Clones D116E11 (ggtc)
Private Clones OST443691 (lexicon) OST302713 (lexicon) OST194584 (lexicon) OST184859 (lexicon)
OST68678 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24563
Vector Insertion
Chr 13: 63400965 - 63403086
Public Clones CMHD-GT_401H11-3 (cmhd)
Private Clones OST214951 (lexicon) OST184466 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021911
Sequence
ATGGACATAAAGCTGGACCCTTCCCGGGATGATCTGCCTCTCATGGCCAACACCAGCCACATGCTTGTGAAGCACTACATACTGGATTTGGATGTGGACT

TTGGAAATCAAGTCATTGAGGGCAACATAGTGCTTTTCTTTGGAGATGGAAACAGATTTAAAAACCAGTCGCGTTCTACCCAGGAAACCTTCCAGATGGA

GTCAGAGGAGGCTGACATATTTAGGACAGCTGAACCCTGCCATGTTCCTGAGATGGATTCGAGTACCTTCTCACCTAAGATGGGACATAGAGAATGTGCA

GTCTGTGGTAAAGGTGATCAAGATGCCTTTGATAACGATGGTAACCATGACAACCAGGAACGTGATTCTGAGATCTCTAGCTCAAAGTACTGCTGTGACA

CAGGGAATCATGGGAAAAGGGATTTCTTGCTAGTGTTGGACTGCTGTGATTTATCTGTGCTAAAGGTAGAGGAGGTGGATGTGGCTGCTGTGCCAGGCCT

TGAGAAATTTACTAAAGCTCCAAAGCTCTTGGCTACTCCTGAGAAGCTCAGGTGTGAGATTGTCCGTGACCTTGTGGCTCTGCCTGCAGATGCTTGGAGG

GAGCAGTTAGACTGCTACACTCGTTGCAGCCAGGCTCCTGGCTGTGGGGAGCTCTTGATTGACTCTGACAATTGGAGCTTACGGATCAGGAAGACGGGGA

CTTCGACACCTGCTGACTTTCCTCGTGCCATCAGAATATGGTATAAAACTAAACCTGAGGGGCAGTCAGTAGCTTGGACAACAGACCAGAATGGCAG GC

CATGTGTTTATACTATGGGATCCCCCATCAACAACAGGGCCCTTTTTCCATGCCAGGAACCACCCGTTGCCATGTCAACATGGCAGGCTACAGTTCGAGC

AGCTGCATCTTTTGTTGTTTTAATGAGTGGAGAAAATTCTGCCAAGCCCACACCACTTCGAGAAG GATACATGAGCTGGCATTACTATGTGACCATGCC

AATGCCGGCCTCTACCTTTGCAATTGCAGTGGGGTGCTGGACAGAAATGAAGCCCAAGGCATCCCCACCAGATGATCTGATGACTGAGCACTCTCTCCCC

CTCTCGCCATCGGAAGCGGACTTGAG GTATGATAACACCTGCAATCATATGGAATACCCTTGCAGGTTCCAGAGTGCGTCCGCTGCCTCCCAGGACATC

ATTCCTTATCGAGTGTTTGCCCCAGTGTGCCTTGAGGGTGCCTGCCAAGAGGCCCTGCTGTGGCTGATCCCTTCTTGCCTCTCAGCTGCACACTCTGTCC

TGGGAACACACCCTTTCTCCCGGCTGGACATACTCATTGTCCCCACCAACTTTCCAAGTCTGGGAATGGCCAG CCCACACATCATCTTCCTCTCTCAGA

GCACCTTAACAGGCACGAGCCATCTCTGTGGGACCCGTCTTTGCCATGAAATTGCTCACTCCTGGTTTGGCCTAGCCATTGGGGCCCGAGACTGGACAGA

GGAGTGGCTCAGTGAAGGATTTGCCACGCATTTGGAAGATATATTTTGGGCTGAGGCACAGCAG CTGCCCCCCCATGAGGCCCTGGAGCAGCAGGAGCT

GAGGGCTTGCCTGCGCTGGCACCGCCTGCAGGATGAGCTTCGGAACTCCCCAGAGGGAATGCAGGTGTTAAG ACCCAACAAAGAAGAGACTGGCCATGT

GAGTGCTTCAGGTGCATCTGTTGTCAAGCATGGACTCAATCCAGAGAAGGGCTTCATGCAGGTTCATTACTTAAAG GGCTACTTCCTTCTTCGGTTCCT

AACCAGAACACTTGGAGAGAAAATTTATTTTCCGTTTTTAAGAAAATTTGTGCATCTGTTTCATGGGCAGCTGATTCTTTCCCAG GATTTTCTTCAAAT

GCTGTTGGAGAACATTCCAGAAAACAAAAG GCTCGGCCTGTCTGTTGAGAACATCGTCCGAGATTGGCTTGAGTGTTCCGGAATACCTAAG GCGCTGC

AGGAGGAGCGCAAGGCCGAGGACTGCTCGCCGAGTAGGCTCGCACGGCAAGTAGGCTCCGAG - UNI11349 - GTGGCGAAATGGATTCGAGTCAAC

CGCAGACCCCGAAAACGCAAACGAGGGAAGCGAGAAGTCGCCTTTGAAAAG - UNI14617 - CTTTCTCCAGACCAGATCGTCTTGCTTTTGGAGTG

GCTCTTAGAGCAGAAGACGCTGAGCCCTCAGACACTGCACTGTCTCCAGCAGACTTACCATCTCCCAGAGCAGGATGCAGAG - UNI2350 - GTTCG

CCATCGATGGTGTGAACTGGTTATTAAGCACAAGTACACAAAGGCATACAATCAGGTGGAGAGGTTCCTACTGGAGGACCAG - UNI17382 - GCCA

TGGGCATATACCTGTATGGGGAGCTGATGGTGAGTGAGGACGCCAGGCTGCAGCAGCTAGCCCACAGGTGCTTTGAGCTGGTGAAGGAACACATGGACAG

AGCATCGGCCCAGGTGGTGACTGAAATGCTGTTCTAAAGAG - UNI24563 - GACAGATCACAGTGAGATTCTCATATACCTTCTCCTAGCCCTGGT

GGGGCCAGGACTGCACTGACCCTGGACATCAAAGGGAGGATTATGTGGCTGCTAAGGCCATCAGCCCACAGCAGTGGTTGGTCCATCTTGGGCTTCCAGA

GACTGGGCTCCCGTGGCATATATAAAAGGCGGAGCCTCATAAACTGTTGCACCTGGCAGCTGCCTTTGTTCCCAGTCCTAGAGAGACTGAGTCTACACAC

TGGAATTGAGCTGTGACTTTAAGGCAGTCATTCAATGAAGGACACCCTCCCCTAGGCAGATGGAGAGCCGGTTGCCTGCTTCCTGTGATTGCAAAAACTA

GCTGCCATGCTCTGAGACTGCAGAATCATGTGACACCTCCTGTGGCTGGTCCCCAAGGATTCTGCAAAGCCCTTTTGATGTGTTCAGTCAACAGAGCATT

CCTGTTTTTGAAAATGCAGGAAAGCCTAAAATGTCTTAATAAAGTACCAGATTTGCTAGTG
Translation
MDIKLDPSRDDLPLMANTSHMLVKHYILDLDVDFGNQVIEGNIVLFFGDGNRFKNQSRSTQETFQMESEEADIFRTAEPCHVPEMDSSTFSPKMGHRECA

VCGKGDQDAFDNDGNHDNQERDSEISSSKYCCDTGNHGKRDFLLVLDCCDLSVLKVEEVDVAAVPGLEKFTKAPKLLATPEKLRCEIVRDLVALPADAWR

EQLDCYTRCSQAPGCGELLIDSDNWSLRIRKTGTSTPADFPRAIRIWYKTKPEGQSVAWTTDQNGR RPCVYTMGSPINNRALFPCQEPPVAMSTWQATV

RAAASFVVLMSGENSAKPTPLREG GYMSWHYYVTMPMPASTFAIAVGCWTEMKPKASPPDDLMTEHSLPLSPSEADLR RYDNTCNHMEYPCRFQSASA

ASQDIIPYRVFAPVCLEGACQEALLWLIPSCLSAAHSVLGTHPFSRLDILIVPTNFPSLGMAS SPHIIFLSQSTLTGTSHLCGTRLCHEIAHSWFGLAI

GARDWTEEWLSEGFATHLEDIFWAEAQQ LPPHEALEQQELRACLRWHRLQDELRNSPEGMQVLR RPNKEETGHVSASGASVVKHGLNPEKGFMQVHYL

K GYFLLRFLTRTLGEKIYFPFLRKFVHLFHGQLILSQ DFLQMLLENIPENKR RLGLSVENIVRDWLECSGIPK ALQEERKAEDCSPSRLARQVGSE

 - UNI11349 - VAKWIRVNRRPRKRKRGKREVAFEK - UNI14617 - LSPDQIVLLLEWLLEQKTLSPQTLHCLQQTYHLPEQDAE - UNI23

50 - VRHRWCELVIKHKYTKAYNQVERFLLEDQ - UNI17382 - AMGIYLYGELMVSEDARLQQLAHRCFELVKEHMDRASAQVVTEMLF - UNI

24563 - 
Transcript ENSMUST00000091560
Sequence
AGATAAGATAGCCAACCTGCAGGATCTGCAACTGCAGGGACATTTAGGGTCTTATTTGGAATTTTATCTAACCATACTTTTTTCTTTGCCAGGGAATTGA

AAGTTGTGGAAAGATAACGAGTGCCAGTGGGTGCTTCTTATTTGGTAAACCAGCCATTTGTGATTCTGAGCTACTACAGGAGATTAGAAGCTTCAGCTGA

GATTCAGCAAAGCTACCAACTGCAGACTACACCATGGACATAAAGCTGGACCCTTCCCGGGATGATCTGCCTCTCATGGCCAACACCAGCCACATGCTTG

TGAAGCACTACATACTGGATTTGGATGTGGACTTTGGAAATCAAGTCATTGAGGGCAACATAGTGCTTTTCTTTGGAGATGGAAACAGATTTAAAAACCA

GTCGCGTTCTACCCAGGAAACCTTCCAGATGGAGTCAGAGGAGGCTGACATATTTAGGACAGCTGAACCCTGCCATGTTCCTGAGATGGATTCGAGTACC

TTCTCACCTAAGATGGGACATAGAGAATGTGCAGTCTGTGGTAAAGGTGATCAAGATGCCTTTGATAACGATGGTAACCATGACAACCAGGAACGTGATT

CTGAGATCTCTAGCTCAAAGTACTGCTGTGACACAGGGAATCATGGGAAAAGGGATTTCTTGCTAGTGTTGGACTGCTGTGATTTATCTGTGCTAAAGGT

AGAGGAGGTGGATGTGGCTGCTGTGCCAGGCCTTGAGAAATTTACTAAAGCTCCAAAGCTCTTGGCTACTCCTGAGAAGCTCAGGTGTGAGATTGTCCGT

GACCTTGTGGCTCTGCCTGCAGATGCTTGGAGGGAGCAGTTAGACTGCTACACTCGTTGCAGCCAGGCTCCTGGCTGTGGGGAGCTCTTGATTGACTCTG

ACAATTGGAGCTTACGGATCAGGAAGACGGGGACTTCGACACCTGCTGACTTTCCTCGTGCCATCAGAATATGGTATAAAACTAAACCTGAGGGGCAGTC

AGTAGCTTGGACAACAGACCAGAATGGCAG GCCATGTGTTTATACTATGGGATCCCCCATCAACAACAGGGCCCTTTTTCCATGCCAGGAACCACCCGT

TGCCATGTCAACATGGCAGGCTACAGTTCGAGCAGCTGCATCTTTTGTTGTTTTAATGAGTGGAGAAAATTCTGCCAAGCCCACACCACTTCGAGAAG G

ATACATGAGCTGGCATTACTATGTGACCATGCCAATGCCGGCCTCTACCTTTGCAATTGCAGTGGGGTGCTGGACAGAAATGAAGCCCAAGGCATCCCCA

CCAGATGATCTGATGACTGAGCACTCTCTCCCCCTCTCGCCATCGGAAGCGGACTTGAG GTATGATAACACCTGCAATCATATGGAATACCCTTGCAGG

TTCCAGAGTGCGTCCGCTGCCTCCCAGGACATCATTCCTTATCGAGTGTTTGCCCCAGTGTGCCTTGAGGGTGCCTGCCAAGAGGCCCTGCTGTGGCTGA

TCCCTTCTTGCCTCTCAGCTGCACACTCTGTCCTGGGAACACACCCTTTCTCCCGGCTGGACATACTCATTGTCCCCACCAACTTTCCAAGTCTGGGAAT

GGCCAG CCCACACATCATCTTCCTCTCTCAGAGCACCTTAACAGGCACGAGCCATCTCTGTGGGACCCGTCTTTGCCATGAAATTGCTCACTCCTGGTT

TGGCCTAGCCATTGGGGCCCGAGACTGGACAGAGGAGTGGCTCAGTGAAGGATTTGCCACGCATTTGGAAGATATATTTTGGGCTGAGGCACAGCAG CT

GCCCCCCCATGAGGCCCTGGAGCAGCAGGAGCTGAGGGCTTGCCTGCGCTGGCACCGCCTGCAGGATGAGCTTCGGAACTCCCCAGAGGGAATGCAGGTG

TTAAG ACCCAACAAAGAAGAGACTGGCCATGTGAGTGCTTCAGGTGCATCTGTTGTCAAGCATGGACTCAATCCAGAGAAGGGCTTCATGCAGGTTCAT

TACTTAAAG GGCTACTTCCTTCTTCGGTTCCTAACCAGAACACTTGGAGAGAAAATTTATTTTCCGTTTTTAAGAAAATTTGTGCATCTGTTTCATGGG

CAGCTGATTCTTTCCCAG GATTTTCTTCAAATGCTGTTGGAGAACATTCCAGAAAACAAAAG GCTCGGCCTGTCTGTTGAGAACATCGTCCGAGATTG

GCTTGAGTGTTCCGGAATACCTAAG GCGCTGCAGGAGGAGCGCAAGGCCGAGGACTGCTCGCCGAGTAGGCTCGCACGGCAAGTAGGCTCCGAG - UN

I11349 - GTGGCGAAATGGATTCGAGTCAACCGCAGACCCCGAAAACGCAAACGAGGGAAGCGAGAAGTCGCCTTTGAAAAG - UNI14617 - CT

TTCTCCAGACCAGATCGTCTTGCTTTTGGAGTGGCTCTTAGAGCAGAAGACGCTGAGCCCTCAGACACTGCACTGTCTCCAGCAGACTTACCATCTCCCA

GAGCAGGATGCAGAG - UNI2350 - GTTCGCCATCGATGGTGTGAACTGGTTATTAAGCACAAGTACACAAAGGCATACAATCAGGTGGAGAGGTTC

CTACTGGAGGACCAG - UNI17382 - GCCATGGGCATATACCTGTATGGGGAGCTGATGGTGAGTGAGGACGCCAGGCTGCAGCAGCTAGCCCACAG

GTGCTTTGAGCTGGTGAAGGAACACATGGACAGAGCATCGGCCCAGGTGGTGACTGAAATGCTGTTCTAAAGAGGTAATTCTCTTTTCTTTCTTCTAACC

ATCCATGTCAATTGGTAAGCCACATGATGAGCCACAGCACCAGAGGGCTGCCAAACGGTCTTGGGGAGGAAGCAGCAAGGTGGGTCCTCAGGAACAGGAA

GAAGGCTCAGGATCTCTGGAGCACCTCACCTGCTGGAAGCATGGGTGTGAAGCAGGTACAGCTGAAGGAGCAACAGATCTGGCACTGCTTTAGCCACCCT

GGATTTTGCACAGGTCCACAGGCTCCAGGGTCAAGGTCAACACAGCGGTCCATGGCCTCATTGCTCCAGGCTTCAGCATGCAGGCATCTCTCCTAGAGGC

TGTGTAAACCTGAGACTCCTTGGCCTCTGGTTCTCTGACCTGTAGAGTAGGCAGCAGGTCTTCTCTGCCCCTCCATCCAAGTGACACTTGCGTCCTAAAG

GCAAGTCTGTTTCCATCTCGTGCTGGAACAGGATTTACGCTGGCTCCCAGAGTCCTTGGCTGTGGTGTAACTTGCCTCCTCTGTAGCCAGCTTGTGGACC

AGTAATGCAGTTCAGCCACAGGGCGTGGAGTTCTGAGACAGGTGTGGGCTAGTGCGTCTCTTTCATAGTCGCCAGTCATCATCTCTACATCATCCCAGGA

CATTATCGCTTGCCATGGTGGTACATATGATGTTTACTTTTGTATATGTTTGAAATTTTACATCAATCACTGTGTTACTCTGTTGTTCTCTATGATTACC

AATTAATGAATATTTAGAATTGTGTTGCTAATCTTAACCCATTGTCAGACATTAAATTTACATTTTCACATTTC
Translation
MDIKLDPSRDDLPLMANTSHMLVKHYILDLDVDFGNQVIEGNIVLFFGDGNRFKNQSRSTQETFQMESEEADIFRTAEPCHVPEMDSSTFSPKMGHRECA

VCGKGDQDAFDNDGNHDNQERDSEISSSKYCCDTGNHGKRDFLLVLDCCDLSVLKVEEVDVAAVPGLEKFTKAPKLLATPEKLRCEIVRDLVALPADAWR

EQLDCYTRCSQAPGCGELLIDSDNWSLRIRKTGTSTPADFPRAIRIWYKTKPEGQSVAWTTDQNGR RPCVYTMGSPINNRALFPCQEPPVAMSTWQATV

RAAASFVVLMSGENSAKPTPLREG GYMSWHYYVTMPMPASTFAIAVGCWTEMKPKASPPDDLMTEHSLPLSPSEADLR RYDNTCNHMEYPCRFQSASA

ASQDIIPYRVFAPVCLEGACQEALLWLIPSCLSAAHSVLGTHPFSRLDILIVPTNFPSLGMAS SPHIIFLSQSTLTGTSHLCGTRLCHEIAHSWFGLAI

GARDWTEEWLSEGFATHLEDIFWAEAQQ LPPHEALEQQELRACLRWHRLQDELRNSPEGMQVLR RPNKEETGHVSASGASVVKHGLNPEKGFMQVHYL

K GYFLLRFLTRTLGEKIYFPFLRKFVHLFHGQLILSQ DFLQMLLENIPENKR RLGLSVENIVRDWLECSGIPK ALQEERKAEDCSPSRLARQVGSE

 - UNI11349 - VAKWIRVNRRPRKRKRGKREVAFEK - UNI14617 - LSPDQIVLLLEWLLEQKTLSPQTLHCLQQTYHLPEQDAE - UNI23

50 - VRHRWCELVIKHKYTKAYNQVERFLLEDQ - UNI17382 - AMGIYLYGELMVSEDARLQQLAHRCFELVKEHMDRASAQVVTEMLF

For any suggestions or comments, please send an email to unitrap@crg.es