Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021497 (Txndc15)
Chromosomal location
Chr 13: 55816104 - 55827591 (+)
Description
thioredoxin domain containing 15 Gene [Source:MGI Symbol;Acc:MGI:1916922]
RefSeq_dna
NM_175150 
RefSeq_peptide
NP_780359.2 
UniGene
Mm.294457 
MGI
MGI:1916922 
Uniprot/SWISSPROT
Q6P6J9 
Human Ortholog
ENSG00000113621 (C5orf14)
Omim not available
UniTrap UNI20184
Vector Insertion
Chr 13: 55816206 - 55819152
Public Clones not available
Private Clones OST369969 (lexicon) OST237556 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26592
Vector Insertion
Chr 13: 55826000 - 55827027
Public Clones not available
Private Clones OST109139 (lexicon) OST101368 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021959
Sequence
GCGGTGGCTGTCGCCGCGGCTCCCTGTCGCGCGCCATGCAACTCCTCTGCTGGTGGCAAGTCCTGCTGTGGGTGCTGGGCCTTCCGGCCCACGGCCTGGA

GG - UNI20184 - TTGCAGAGGACAGTGGTCACCCCTGGCGGGAGGAGCGGCCTGTCCCTGCTCTCCAGGTAGGAGCTGTGTATCTGCATGAAGAGG

AGGTTGCTCAGGACCATCGGGACCAGGCAAGAGCGGCGGAACCCATGGAGGCCTCTCTGGGTCCGCGCGGAGATCCCATGGTGGTGCTGTCAGTGGTCCC

TGGGGCAGCTGAGGACCAACGGAGCCCCGAGGCCCACGATGGCACCTGCAGTGCGCAGGGAGAGGAGGACCCGAGCTGTGGCCGAGAGAACCTCTTCGGG

CTGCAGGGGGCAGGCGGCTTCCAGGATCGGGAAGAGGAGTACTATGCTGAGCCTGGCGTGACTGAGGCCGAGCCTGTAGCCACCGAGGATGCCAACAGCA

CTGACAGCCTCAAGTCCCCCAAGGTGAATTGTGAGGAGAGGAATGTGACTGGGCTAGAAAACTTCACTCTGAAGATTTTAAATATGTCCCAG GACCTCA

TGGATTTCCTAAACCCAAATGGTAGTGACTGTACACTGGTCCTCTTCTACACCCCGTGGTGCCGGTTTTCTGCCAGCCTGGCTCCTCATTTTAACTCCCT

GCCCCGGGCGTTTCCAACACTTGGCTTCTTGGCTCTGGATGCATCTCAGCACAGCAG CCTTTCTACCAGATTTGGCACTGTAGCTGTCCCTAACATTTT

GTTATTTCAAGGAGCTAAACCAATGGCAAGGTTTAACCATACAGATCGCACCCTGGAAACACTGAAAATCTTCATTTTCAATCAGACGG - UNI26592

 - GTATAGAAGCCAAGAAAAATGTGGTGGTAACGCAGGCTGACCAGATGGGCCCTCTCCCCAGCACTTTGATAAAGACTGTGGATTGGTTGCTGGTGTT

TTCCTTGTTCTTTTTAATTAGTTTCATTATGTATGCTACCATCCGCACTGAGAGTATTCGGTGGCTGATTCCAGGACAAGAACAGGAACACGCAGAGTAA

AGACAGAACTGAACTGGAACAAGAGGGGTCTCAGCCCCTCCTTTGTGGACTTAGCATTACAGTCGCTAAATGTGTGGACTTGCAACGGAAATCAGATTCA

AGAATCATGTTCTTGTTGGACTACTGAAAAGCTGAAAAGATTTCATATAAATGTGTTTTTCCTATGACAACTAGCAGGTACAAAAATGTCCACTAGAATT

GACTGTTGTTGCTTTTTAATACTTGAACATAATGAATTTCTTTTCTAGTGTCGTCAAACAGGAAAGTGTTGTCTCAGAAGAGGAGCTAAGATGGGAAGTA

TGGGCTAGGACGGGAAGTGCAGGTCTACTACAGGACCAGGTGAAAAATAAAGTCACTGAAACAATTC
Translation
MQLLCWWQVLLWVLGLPAHGLEV - UNI20184 - VAEDSGHPWREERPVPALQVGAVYLHEEEVAQDHRDQARAAEPMEASLGPRGDPMVVLSVVPG

AAEDQRSPEAHDGTCSAQGEEDPSCGRENLFGLQGAGGFQDREEEYYAEPGVTEAEPVATEDANSTDSLKSPKVNCEERNVTGLENFTLKILNMSQ DLM

DFLNPNGSDCTLVLFYTPWCRFSASLAPHFNSLPRAFPTLGFLALDASQHSS SLSTRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTG -

 UNI26592 - GIEAKKNVVVTQADQMGPLPSTLIKTVDWLLVFSLFFLISFIMYATIRTESIRWLIPGQEQEHAE

For any suggestions or comments, please send an email to unitrap@crg.es