Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021536 (Adcy2)
Chromosomal location
Chr 13: 68758920 - 69138419 (-)
Description
adenylate cyclase 2 Gene [Source:MGI Symbol;Acc:MGI:99676]
RefSeq_dna
NM_153534 
RefSeq_peptide
NP_705762.2 
UniGene
Mm.390617 
MGI
MGI:99676 
Uniprot/SWISSPROT
Q80TL1 
Uniprot/SPTREMBL
Q3V1Q3 
Human Ortholog
ENSG00000078295 (ADCY2)
Omim not available
UniTrap UNI31639
Vector Insertion
Chr 13: 68935407 - 69026999
Public Clones IST14543E6 (tigm) IST12972D8 (tigm) IST10159D9 (tigm) IST11186F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31971
Vector Insertion
Chr 13: 68873501 - 68877575
Public Clones IST10861F10 (tigm) IST13264B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022013
Sequence
GCCCTCGCGAGCGGTGGTGGCGGCGGCGGCGCCCGGGAGCTGCCCTGAGGCCGCCCCCGGCCCCCGCCCGCGCGTCAGCGCGCCCAGCCCGGGGCTCCGA

GCTCCGCCCGCGCCCGAGGCCCCTGAGCACAGCTCCGGGCGGGCAGCCGGCGGGTCGCGAAGCGCGGGGGCGGCAGGCGGTAGGTGACCACAGAGCGGCG

CTGCCCGGGCAGGGCGCGCACAGCGGGCGCCCCGCGAGCCGCCCCGATGTGGCAGGAGGCGATGCGGCGGCGCCGCTACCTGCGGGACCGCGCCGAGGCG

GCGGCAGCAGCGGCGGCGGGCGGCGGCGAGGGGCTGCAGCGGTCCCGGGACTGGCTCTACGAGTCCTACTACTGCATGAGCCAGCAGCACCCTCTCATCG

TCTTCCTGCTGCTCATCGTCATGGGCGCCTGCCTCGCCCTGCTCGCCGTCTTCTTCGCGCTCGGGCTG GAGGTAGAAGACCATGTGGCATTTTTAATAA

CCGTTCCCACTGCCCTGGCCATCTTCTTCGCCATATTCATTCTTGTCTGCATTGAGTCTGTGTTCAAGAAGCTTCTCCGAGTGTTCTCGCTGGTGATCTG

GATATGTCTGGTTGCCATGGGATACCTGTTCATGTGCTTTGGAGGGACCGTGTCTGCCTGGGACCAG - UNI31639 - GTGTCATTCTTCCTCTTCA

TCATCTTCGTGGTGTACACCATGCTTCCCTTCAACATGAGGGATGCCATCATCGCCAGCGTCCTCACCTCTTCATCTCATACGATAGTGCTGAGTGTCTA

CCTGTCTGCAACACCAGGGGCCAAGGAGCACCTGTTCTGGCAG - UNI31639 - ATACTGGCCAACGTGATCATTTTCATCTGTGGGAACTTGGCGG

GAGCTTACCATAAGCACCTCATGGAACTTGCCCTGCAGCAAACCTATCGGGACACATGTAATTGCATCAAGTCCCGGATCAAGCTGGAATTTGAAAAACG

GCAGCAG - UNI31639 - - UNI31971 - GAACGACTTCTGCTTTCCCTGCTGCCTGCTCACATTGCCATGGAAATGAAGGCTGAAATCATTCAA

AGGCTACAGGGACCCAAAGCAGGACAGATGGAAAACACGAACAACTTCCACAACCTGTATGTCAAGCGACACACCAACGTGAG - UNI31971 - CAT

ATTATATGCTGACATTGTTGGCTTCACCCGCCTTGCAAGCGATTGCTCCCCTGGTGAACTGGTCCACATGCTGAATGAACTCTTTGGGAAGTTTGATCAA

ATTGCAAAG - UNI31971 - GAGAATGAGTGCATGAGAATTAAAATTTTAGGAGACTGCTATTACTGTGTTTCCGGGCTCCCGATATCTCTCCCTAA

CCATGCCAAGAACTGTGTGAAAATGGGACTGGATATGTGCGAAGCCATAAA GAAAGTGAGGGATGCTACTGGGGTCGATATCAACATGCGCGTGGGAGT

GCATTCTGGGAACGTTCTCTGTGGTGTGATTGGTCTCCAGAAGTGGCAGTATGACGTGTGGTCTCATGATGTTACTTTGGCCAACCACATGGAAGCTGGA

GGAGTCCCTGG ACGTGTTCACATTTCCTCAGTCACTCTGGAGCACTTGAATGGGGCTTATAAAGTGGAGGAAGGAGACGGTGAGATAAGAGACCCATAT

TTAAAGCAGCATTTGGTGAAAACCTACTTTGTAATCAACCCCAAG GGAGAAAGACGGAGTCCTCAGCATCTCTTCAGACCTCGACACACTCTGGATGGA

GCCAAGATGAGAGCATCTGTCCGCATGACCCGGTACTTGGAGTCCTGGGGAGCAGCCAAGCCATTTGCACATCTGCACCACAGAGATAGCATGACCACAG

AGAATGGGAAGATTAGCACCACG GATGTGCCAATGGGTCAACATAATTTTCAAAATCGCACCTTAAG AACTAAGTCACAGAAGAAGCGATTCGAAGAA

GAACTGAATGAAAGGATGATCCAAGCAATTGACGGGATCAACGCACAAAA GCAATGGCTCAAGTCAGAAGACATTCAAAGAATCTCCCTGTTTTTCTAT

AACAAAAATATAGAAAAAGAA TATCGAGCCACTGCACTGCCAGCATTCAAGTACTACGTGACCTGTGCCTGCCTCATCTTCCTCTGTATCTTCATTGTA

CAGATTCTTGTACTGCCAAA AACGTCCATCCTTGGCTTCTCCTTTGGAGCTGCATTTCTCTCCCTCATCTTCATCCTCTTTGTCTGCTTCGCTGGACAG

CTTTTG CAATGCAGCAAAAAGGCCTCTGCCTCTCTCTTGTGGCTTTTGAAATCATCAGGCATCATAGCCAACCGCCCATGGCCACGGATCTCCCTCACG

ATCGTCACCACAGCTATCATACTAACCATGGCTGTGTTTAACATG TTTTTCCTGAGCAACTCTGAGGAGACAACCCTTCCGACTGCCAATGCATCTAAT

GCAAACGTTTCTGTCCCAGACAACCAGACAGCAATTCTTCATGCACGAAACTTGTTTTTCCTCCCG TACTTCATATACAGCTGCATTCTGGGTTTGATC

TCCTGCTCCGTTTTCCTGAGGGTGAACTACGAGTTGAAAATGTTAATCATGATGGTGGCACTCGTGGGCTACAACATCATTCTGCTCCACACCCATGCCC

ATGTCCTGGATGCATACAGCCAGGTCCTGTTTCAGAG ACCAGGCATTTGGAAAGACCTGAAGACCATGGGCTCTGTGTCCCTCTCTATATTCTTCATCA

CGCTGCTCGTTCTGGGTAGACAG AGTGAATATTACTGTAGGTTAGACTTCTTGTGGAAGAACAAGTTCAAAAAAGAGCGGGAGGAGATCGAAACCATGG

AGAACCTAAACCGAGTGCTGCTGGAGAACGTGCTACCTGCACACGTGGCTGAACACTTCCTGGCCAGGAGCCTGAAAAACGAG GAGTTGTACCACCAGT

CCTACGATTGTGTCTGTGTCATGTTTGCCTCCATTCCGGACTTCAAGGAATTCTACACGGAGTCAGATGTGAACAAGGAAGGCTTGGAATGCCTCCGGCT

CCTGAATGAGATCATCGCTGACTTTGATGAT CTGCTTTCCAAGCCGAAGTTCAGTGGCGTTGAAAAGATCAAGACCATTGGTAGCACATACATGGCAGC

CACGGGTCTGAGTGCTGTACCCAGTCAGGAGCACGCCCAG GAACCCGAGCGTCAATACATGCACATAGGCACCATGGTGGAGTTTGCATACGCCCTGGT

GGGGAAACTGGATGCCATCAATAAGCACTCCTTCAACGACTTCAAACTTCGAGTGG GTATCAACCATGGACCTGTAATAGCTGGCGTCATAGGGGCTCA

GAAGCCACAATATGACATCTGGGGCAACACTGTCAACGTCGCTAGTAGGATGGACAGCACCGGAGTCCTGGACAAAATACAG GTGACTGAGGAGACAAG

CCTCATCCTGCAGACGCTTGGCTACACGTGTACATGTCGAGGTATCATCAACGTGAAGGGGAAAGGGGACCTGAAGACGTACTTTGTAAACACCGAGATG

TCACGGTCCCTTTCTCAGAGCAACTTGGCTTCCTGAGAAGCTGTCTCTTCCTGACAAGAAGCGTGTGCTTGCAGGAAGGTACCACGCACTTTCTGACTGC

AGCCCTTCCCCTTCGTCTTGATTACGTACGTGCTCTGTCCCACCCTCTGGAGCCCTTGCAGACTAGTTCCTGTGACCCAGTGGCATACTGTTTGGTGTCT

GCGTGTGCCCAGATTGTCCTGCCACTTGCACTGTGCTTGCTCCTAAGCAGAAGGAGAAGGAACCGTGTCCTGGAAGGAGAGCATTGGAAGAAGTGATGGA

GGAAGAGGTGAAGTGAACACACATTCTTAAGGCAATAAAACTGGGGGGTGTATATTATCTTCTGGTGCATGTTCTTCTCTGGAAAATACGGTAGCTCGTA

ACCGCATCCCTAGTCTGATACTCAAACCCACAGTATTTGTGAATAAGCTGATCCCGTCACTCAACATGGAGTCTGTGCTCACCCACCCGTGTGTCTCATT

GCCAGTGGTCATCCGCGGGCCTCAGCTGAGACTCGCGGCTTTTGTCACCTTGCTGTGTTGTCTTGTGGCAGCAGCACGTTGCCATCCATTACCAGAATTA

GTCCTCACAGCCTAGGACCGGTTTTGTACCAAACTCGTCTGATGTTTTGATGCCATTTGTCTTTTGTAAGGTTAATTCATTAAAAGTTTTACGTACTTTG

GTGTCTAGTGCCC
Translation
MWQEAMRRRRYLRDRAEAAAAAAAGGGEGLQRSRDWLYESYYCMSQQHPLIVFLLLIVMGACLALLAVFFALGL EVEDHVAFLITVPTALAIFFAIFIL

VCIESVFKKLLRVFSLVIWICLVAMGYLFMCFGGTVSAWDQ - UNI31639 - VSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVYLSATP

GAKEHLFWQ - UNI31639 - ILANVIIFICGNLAGAYHKHLMELALQQTYRDTCNCIKSRIKLEFEKRQQ - UNI31639 - - UNI31971 - 

ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVS - UNI31971 - SILYADIVGFTRLASDCSPGELVHMLNELFGKFDQI

AK - UNI31971 - ENECMRIKILGDCYYCVSGLPISLPNHAKNCVKMGLDMCEAIK KKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHD

VTLANHMEAGGVPG GRVHISSVTLEHLNGAYKVEEGDGEIRDPYLKQHLVKTYFVINPK GERRSPQHLFRPRHTLDGAKMRASVRMTRYLESWGAAKP

FAHLHHRDSMTTENGKISTT DVPMGQHNFQNRTLR RTKSQKKRFEEELNERMIQAIDGINAQK KQWLKSEDIQRISLFFYNKNIEKE YRATALPAF

KYYVTCACLIFLCIFIVQILVLPK KTSILGFSFGAAFLSLIFILFVCFAGQLL QCSKKASASLLWLLKSSGIIANRPWPRISLTIVTTAIILTMAVFN

M FFLSNSEETTLPTANASNANVSVPDNQTAILHARNLFFLP YFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNIILLHTHAHVLDAYSQVLFQR

 RPGIWKDLKTMGSVSLSIFFITLLVLGRQ SEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNE ELYHQSYDCVCVMFA

SIPDFKEFYTESDVNKEGLECLRLLNEIIADFDD LLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHAQ EPERQYMHIGTMVEFAYALVGKLDAINK

HSFNDFKLRVG GINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQ VTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQ

SNLAS

For any suggestions or comments, please send an email to unitrap@crg.es