Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021546 (Hnrnpk)
Chromosomal location
Chr 13: 58493312 - 58503877 (-)
Description
heterogeneous nuclear ribonucleoprotein K Gene [Source:MGI Symbol;Acc:MGI:99894]
RefSeq_peptide
NP_079555.1 
UniGene
Mm.142872 Mm.402529 
MGI
MGI:99894 
Uniprot/SWISSPROT
P61979 
Uniprot/SPTREMBL
Q3U6X2 Q3U9Q3 Q3TL71 Q5FWJ5 B2M1R6 Q3TG17 Q3TJ38 Q3TUA1 
Human Ortholog
ENSG00000165119 (HNRNPK)
Omim not available
UniTrap UNI8590
Vector Insertion
Chr 13: 58501779 - 58503753
Public Clones (sanger) XST137 (baygenomics) RST743 (baygenomics) TEA201 (baygenomics)
RST769 (baygenomics) RST467 (baygenomics) TEA178 (baygenomics) P119E06 (ggtc)
D032C05 (ggtc) M061B01 (ggtc) D034E08 (ggtc) A030B03 (ggtc) IST11607C5 (tigm)
IST14414G7 (tigm) IST14414H7 (tigm)
Private Clones OST359508 (lexicon) OST338837 (lexicon) OST283779 (lexicon) OST282725 (lexicon)
OST206091 (lexicon) OST177139 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29537
Vector Insertion
Chr 13: 58501253 - 58501779
Public Clones P095A10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1056
Vector Insertion
Chr 13: 58500574 - 58501253
Public Clones AY0165 (sanger) XR0101 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36367
Vector Insertion
Chr 13: 58499113 - 58500574
Public Clones PST16207-NR (escells) IST10936C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35013
Vector Insertion
Chr 13: 58497548 - 58498261
Public Clones IST14867C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5752
Vector Insertion
Chr 13: 58494727 - 58495052
Public Clones CSI500 (baygenomics) PST23868-NR (escells) PST19878-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109849
Sequence
ACAGAGTGCGCGAACGAGAAAGGAGGAGGGCGCTACAGGCGACAGCGCTGCAGACGCCATTATCCTCTGCTTCTCCGCTGCACGGACGTCGCCGTCGTGC

TCGTCTCCCACTCGATTGCGGCCT - UNI8590 - - UNI29537 - ATTGGTGGATCCATTTAATTCAAGAAAATGGAGACCGAACAGCCAGAAGA

AACCTTCCCCAACACCGAAACCAATGGTGAATTTG - UNI29537 - GTAAACGCCCTGCAGAAGATATGGAAGAGGAGCAAGCCTTTAAAAGATCTA

GAAATACTGATGAGATGGTTGAATTGCGCATTTTGCTTCAGAGCAAG - UNI1056 - - UNI29537 - AATGCTGGAGCAGTGATTGGAAAAGGA

GGCAAGAATATTAAGGCTCTCCGTACAGAC TACAATGCCAGTGTTTCAGTCCCAGACAGCAGTGGCCCCGAGCG CATACTGAGTATCAGTGCTGATAT

TGAGACGATTGGAGAAATTCTGAAGAAAATCATCCCTACCTTGGAAGAG TACCAACATTATAAAGGAAGTGACTTTGATTGCGAGTTGAGACTGTTGAT

TCATCAGAGTCTGGCAGGAGGAATAATTGGTGTTAAAGGTGCTAAAATCAAAGAACTTCGAGAA AACACTCAGACAACAATCAAGCTTTTCCAGGAGTG

CTGCCCTCACTCTACTGACAGAGTTGTTCTTATTGGAGGAAAACCTGATAGGGTTGTAGAATGCATCAAGATCATCCTTGACCTTATATCTGAG TCTCC

CATCAAAGGACGTGCACAACCTTATGATCCCAACTTTTATGATGAGACCTATGATTATGGTGGTTTTACAATGATGTTTGATGACCGCCGAGGACGACCT

GTGGGATTCCCCATGAGGGGAAGAGGTGGTTTTGACAGAATGCCTCCTGGTCGGGGTGGGCGTCCCATGCCTCCTTCTAGAAGAGATTATGATGATATGA

GCCCTCGTCGAGGACCTCCACCACCACCACCTGGTCGAGGTGGCCGGGGTGGCAGCAGAGCCCGGAATCTGCCTCTTCCTCCTCCACCACCACCCAGAGG

GGG AGATCTAATGGCTTATGACAGAAGAGGAAGGCCTGGAGACCGCTATGATGGCATG GTTGGGTTCAGTGCTGATGAAACTTGGGATTCTGCAATTG

ACACATGGAGCCCATCAGAATGGCAAATGGCTTATGAACCACAG GGTGGTTCTGGATATG ACTATTCTTATGCAGGGGGCCGTGGCTCATATGGTGAT

CTTGGCGGACCTATTATCACTACACAAGTAACTATTCCCAAAGAT - UNI5752 - TTGGCTGGATCTATTATTGGCAAAGGTGGTCAGCGGATTAAA

CAAATTCGTCATGAATCTGGAGCATCAATCAAAATTGATGAACCTTTAGAAGGATCTGAAGATCGGATCATTACCATTACAGGAACACAGGACCAGATAC

AGAACGCACAGTATTTGCTGCAGAACAG CTTCCA CAGTATGCAGATGTTGAAGGATTCTAATGCAAGATATTTTTTCTTT TATAGTGTGAAGCAGTA

TTCTGGAAAGTTTTTCTAA
Translation
 - UNI8590 - - UNI29537 - METEQPEETFPNTETNGEFG - UNI29537 - GKRPAEDMEEEQAFKRSRNTDEMVELRILLQSK - UNI1

056 - - UNI29537 - NAGAVIGKGGKNIKALRTD YNASVSVPDSSGPER RILSISADIETIGEILKKIIPTLEE YQHYKGSDFDCELRLLIHQ

SLAGGIIGVKGAKIKELRE NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISE SPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPV

GFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGG GDLMAYDRRGRPGDRYDGM VGFSADETWDSA

IDTWSPSEWQMAYEPQ GGSGYD DYSYAGGRGSYGDLGGPIITTQVTIPKD - UNI5752 - LAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSED

RIITITGTQDQIQNAQYLLQNS SFH HSMQMLKDSNARYFFF YSVKQYSGKFF
Transcript ENSMUST00000116403
Sequence
ACAGAGTGCGCGAACGAGAAAGGAGGAGGGCGCTACAGGCGACAGCGCTGCAGACGCCATTATCCTCTGCTTCTCCGCTGCACGGACGTCGCCGTCGTGC

TCGTCTCCCACTCGATTGCGGCCT - UNI8590 - - UNI29537 - ATTGGTGGATCCATTTAATTCAAGAAAATGGAGACCGAACAGCCAGAAGA

AACCTTCCCCAACACCGAAACCAATGGTGAATTTG - UNI29537 - GTAAACGCCCTGCAGAAGATATGGAAGAGGAGCAAGCCTTTAAAAGATCTA

GAAATACTGATGAGATGGTTGAATTGCGCATTTTGCTTCAGAGCAAG - UNI1056 - - UNI29537 - AATGCTGGAGCAGTGATTGGAAAAGGA

GGCAAGAATATTAAGGCTCTCCGTACAGAC TACAATGCCAGTGTTTCAGTCCCAGACAGCAGTGGCCCCGAGCG CATACTGAGTATCAGTGCTGATAT

TGAGACGATTGGAGAAATTCTGAAGAAAATCATCCCTACCTTGGAAGAG GGCCTGCAGTTGCCATCACCCACTGCAACCAGCCAGCTCCCGCTCGAATC

TGATGCTGTGGAATGCTTAAAT TACCAACATTATAAAGGAAGTGACTTTGATTGCGAGTTGAGACTGTTGATTCATCAGAGTCTGGCAGGAGGAATAAT

TGGTGTTAAAGGTGCTAAAATCAAAGAACTTCGAGAA AACACTCAGACAACAATCAAGCTTTTCCAGGAGTGCTGCCCTCACTCTACTGACAGAGTTGT

TCTTATTGGAGGAAAACCTGATAGGGTTGTAGAATGCATCAAGATCATCCTTGACCTTATATCTGAG TCTCCCATCAAAGGACGTGCACAACCTTATGA

TCCCAACTTTTATGATGAGACCTATGATTATGGTGGTTTTACAATGATGTTTGATGACCGCCGAGGACGACCTGTGGGATTCCCCATGAGGGGAAGAGGT

GGTTTTGACAGAATGCCTCCTGGTCGGGGTGGGCGTCCCATGCCTCCTTCTAGAAGAGATTATGATGATATGAGCCCTCGTCGAGGACCTCCACCACCAC

CACCTGGTCGAGGTGGCCGGGGTGGCAGCAGAGCCCGGAATCTGCCTCTTCCTCCTCCACCACCACCCAGAGGGGG AGATCTAATGGCTTATGACAGAA

GAGGAAGGCCTGGAGACCGCTATGATGGCATG GTTGGGTTCAGTGCTGATGAAACTTGGGATTCTGCAATTGACACATGGAGCCCATCAGAATGGCAAA

TGGCTTATGAACCACAG GGTGGTTCTGGATATG ACTATTCTTATGCAGGGGGCCGTGGCTCATATGGTGATCTTGGCGGACCTATTATCACTACACAA

GTAACTATTCCCAAAGAT - UNI5752 - TTGGCTGGATCTATTATTGGCAAAGGTGGTCAGCGGATTAAACAAATTCGTCATGAATCTGGAGCATCA

ATCAAAATTGATGAACCTTTAGAAGGATCTGAAGATCGGATCATTACCATTACAGGAACACAGGACCAGATACAGAACGCACAGTATTTGCTGCAGAACA

G TGTGAAGCAGTATGCAGATGTTGAAGGATTCTAA
Translation
 - UNI8590 - - UNI29537 - METEQPEETFPNTETNGEFG - UNI29537 - GKRPAEDMEEEQAFKRSRNTDEMVELRILLQSK - UNI1

056 - - UNI29537 - NAGAVIGKGGKNIKALRTD YNASVSVPDSSGPER RILSISADIETIGEILKKIIPTLEE GLQLPSPTATSQLPLESDA

VECLN YQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRE NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISE SPIKGRAQPYD

PNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGG GDLMAYD

RRGRPGDRYDGM VGFSADETWDSAIDTWSPSEWQMAYEPQ GGSGYD DYSYAGGRGSYGDLGGPIITTQVTIPKD - UNI5752 - LAGSIIGKGG

QRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNS SVKQYADVEGF
Transcript ENSMUST00000116404
Sequence
ACAGAGTGCGCGAACGAGAAAGGAGGAGGGCGCTACAGGCGACAGCGCTGCAGACGCCATTATCCTCTGCTTCTCCGCTGCACGGACGTCGCCGTCGTGC

TCGTCTCCCACTCGATTGCGGCCT - UNI8590 - - UNI29537 - ATTGGTGGATCCATTTAATTCAAGAAAATGGAGACCGAACAGCCAGAAGA

AACCTTCCCCAACACCGAAACCAATGGTGAATTTG - UNI29537 - GTAAACGCCCTGCAGAAGATATGGAAGAGGAGCAAGCCTTTAAAAGATCTA

GAAATACTGATGAGATGGTTGAATTGCGCATTTTGCTTCAGAGCAAG - UNI1056 - - UNI29537 - AATGCTGGAGCAGTGATTGGAAAAGGA

GGCAAGAATATTAAGGCTCTCCGTACAGAC TACAATGCCAGTGTTTCAGTCCCAGACAGCAGTGGCCCCGAGCG CATACTGAGTATCAGTGCTGATAT

TGAGACGATTGGAGAAATTCTGAAGAAAATCATCCCTACCTTGGAAGAG TACCAACATTATAAAGGAAGTGACTTTGATTGCGAGTTGAGACTGTTGAT

TCATCAGAGTCTGGCAGGAGGAATAATTGGTGTTAAAGGTGCTAAAATCAAAGAACTTCGAGAA AACACTCAGACAACAATCAAGCTTTTCCAGGAGTG

CTGCCCTCACTCTACTGACAGAGTTGTTCTTATTGGAGGAAAACCTGATAGGGTTGTAGAATGCATCAAGATCATCCTTGACCTTATATCTGAG TCTCC

CATCAAAGGACGTGCACAACCTTATGATCCCAACTTTTATGATGAGACCTATGATTATGGTGGTTTTACAATGATGTTTGATGACCGCCGAGGACGACCT

GTGGGATTCCCCATGAGGGGAAGAGGTGGTTTTGACAGAATGCCTCCTGGTCGGGGTGGGCGTCCCATGCCTCCTTCTAGAAGAGATTATGATGATATGA

GCCCTCGTCGAGGACCTCCACCACCACCACCTGGTCGAGGTGGCCGGGGTGGCAGCAGAGCCCGGAATCTGCCTCTTCCTCCTCCACCACCACCCAGAGG

GGG AGATCTAATGGCTTATGACAGAAGAGGAAGGCCTGGAGACCGCTATGATGGCATG GTTGGGTTCAGTGCTGATGAAACTTGGGATTCTGCAATTG

ACACATGGAGCCCATCAGAATGGCAAATGGCTTATGAACCACAG GGTGGTTCTGGATATG ACTATTCTTATGCAGGGGGCCGTGGCTCATATGGTGAT

CTTGGCGGACCTATTATCACTACACAAGTAACTATTCCCAAAGAT - UNI5752 - TTGGCTGGATCTATTATTGGCAAAGGTGGTCAGCGGATTAAA

CAAATTCGTCATGAATCTGGAGCATCAATCAAAATTGATGAACCTTTAGAAGGATCTGAAGATCGGATCATTACCATTACAGGAACACAGGACCAGATAC

AGAACGCACAGTATTTGCTGCAGAACAG TGTGAAGCAGTATTCTGGAAAGTTTTTCTAAGACTAGTGAAGAACTGAAGGAGTCCTGCATCTTTTTTTTT

TTATCTGCTTCTGTTTAAAAAGCCAACATTCCTCTGCTTCATAGGTGTTCTGCATTTGAGGTGTAGTGAAATCTTTGCTGTTCACCAGATGTAATGTTTT

AGTTCCTTACAAACAGGGTTGGGGGGAGGGCATGCAAAAACTAACATTGAAATTTTGAAACAGCAGCAGAGTGAGTGACTTTTATTTTTTGTTCATTGTT

GGTGGTTTTAAAAAAAATTCCCCCCATGTAATTATTGTGAACACCTTACTTTGTGGTCACTGTAACATTGGGGGGTGGGACAGGGAGGAAAGTAATAGTC

CACATGTCCCTGGCATTTGTTCAGAGCAGTGTGCAGAATGTAATGCTCTTTTGTAAGAAACGTTTTATGATTTTTAAAATAAATTTAGTGAATCT
Translation
 - UNI8590 - - UNI29537 - METEQPEETFPNTETNGEFG - UNI29537 - GKRPAEDMEEEQAFKRSRNTDEMVELRILLQSK - UNI1

056 - - UNI29537 - NAGAVIGKGGKNIKALRTD YNASVSVPDSSGPER RILSISADIETIGEILKKIIPTLEE YQHYKGSDFDCELRLLIHQ

SLAGGIIGVKGAKIKELRE NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISE SPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPV

GFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGG GDLMAYDRRGRPGDRYDGM VGFSADETWDSA

IDTWSPSEWQMAYEPQ GGSGYD DYSYAGGRGSYGDLGGPIITTQVTIPKD - UNI5752 - LAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSED

RIITITGTQDQIQNAQYLLQNS SVKQYSGKFF
Transcript ENSMUST00000043269
Sequence
ACAGAGTGCGCGAACGAGAAAGGAGGAGGGCGCTACAGGCGACAGCGCTGCAGACGCCATTATCCTCTGCTTCTCCGCTGCACGGACGTCGCCGTCGTGC

TCGTCTCCCACTCGATTGCGGCCT - UNI8590 - - UNI29537 - ATTGGTGGATCCATTTAATTCAAGAAAATGGAGACCGAACAGCCAGAAGA

AACCTTCCCCAACACCGAAACCAATGGTGAATTTG - UNI29537 - GTAAACGCCCTGCAGAAGATATGGAAGAGGAGCAAGCCTTTAAAAGATCTA

GAAATACTGATGAGATGGTTGAATTGCGCATTTTGCTTCAGAGCAAG - UNI1056 - - UNI29537 - AATGCTGGAGCAGTGATTGGAAAAGGA

GGCAAGAATATTAAGGCTCTCCGTACAGAC TACAATGCCAGTGTTTCAGTCCCAGACAGCAGTGGCCCCGAGCG CATACTGAGTATCAGTGCTGATAT

TGAGACGATTGGAGAAATTCTGAAGAAAATCATCCCTACCTTGGAAGAG GGCCTGCAGTTGCCATCACCCACTGCAACCAGCCAGCTCCCGCTCGAATC

TGATGCTGTGGAATGCTTAAAT TACCAACATTATAAAGGAAGTGACTTTGATTGCGAGTTGAGACTGTTGATTCATCAGAGTCTGGCAGGAGGAATAAT

TGGTGTTAAAGGTGCTAAAATCAAAGAACTTCGAGAA AACACTCAGACAACAATCAAGCTTTTCCAGGAGTGCTGCCCTCACTCTACTGACAGAGTTGT

TCTTATTGGAGGAAAACCTGATAGGGTTGTAGAATGCATCAAGATCATCCTTGACCTTATATCTGAG TCTCCCATCAAAGGACGTGCACAACCTTATGA

TCCCAACTTTTATGATGAGACCTATGATTATGGTGGTTTTACAATGATGTTTGATGACCGCCGAGGACGACCTGTGGGATTCCCCATGAGGGGAAGAGGT

GGTTTTGACAGAATGCCTCCTGGTCGGGGTGGGCGTCCCATGCCTCCTTCTAGAAGAGATTATGATGATATGAGCCCTCGTCGAGGACCTCCACCACCAC

CACCTGGTCGAGGTGGCCGGGGTGGCAGCAGAGCCCGGAATCTGCCTCTTCCTCCTCCACCACCACCCAGAGGGGG AGATCTAATGGCTTATGACAGAA

GAGGAAGGCCTGGAGACCGCTATGATGGCATG GTTGGGTTCAGTGCTGATGAAACTTGGGATTCTGCAATTGACACATGGAGCCCATCAGAATGGCAAA

TGGCTTATGAACCACAG GGTGGTTCTGGATATG ACTATTCTTATGCAGGGGGCCGTGGCTCATATGGTGATCTTGGCGGACCTATTATCACTACACAA

GTAACTATTCCCAAAGAT - UNI5752 - TTGGCTGGATCTATTATTGGCAAAGGTGGTCAGCGGATTAAACAAATTCGTCATGAATCTGGAGCATCA

ATCAAAATTGATGAACCTTTAGAAGGATCTGAAGATCGGATCATTACCATTACAGGAACACAGGACCAGATACAGAACGCACAGTATTTGCTGCAGAACA

G TGTGAAGCAGTATTCTGGAAAGTTTTTCTAAGACTAGTGAAGAACTGAAGGAGTCCTGCATCTTTTTTTTTTTATCTGCTTCTGTTTAAAAAGCCAAC

ATTCCTCTGCTTCATAGGTGTTCTGCATTTGAGGTGTAGTGAAATCTTTGCTGTTCACCAGATGTAATGTTTTAGTTCCTTACAAACAGGGTTGGGGGGA

GGGCATGCAAAAACTAACATTGAAATTTTGAAACAGCAGCAGAGTGAGTGACTTTTATTTTTTGTTCATTGTTGGTGGTTTTAAAAAAAATTCCCCCCAT

GTAATTATTGTGAACACCTTACTTTGTGGTCACTGTAACATTGGGGGGTGGGACAGGGAGGAAAGTAATAGTCCACATGTCCCTGGCATTTGTTCAGAGC

AGTGTGCAGAATGTAATGCTCTTTTGTAAGAAACGTTTTATGATTTTTAAAATAAATTTAGTGAATCT
Translation
 - UNI8590 - - UNI29537 - METEQPEETFPNTETNGEFG - UNI29537 - GKRPAEDMEEEQAFKRSRNTDEMVELRILLQSK - UNI1

056 - - UNI29537 - NAGAVIGKGGKNIKALRTD YNASVSVPDSSGPER RILSISADIETIGEILKKIIPTLEE GLQLPSPTATSQLPLESDA

VECLN YQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRE NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISE SPIKGRAQPYD

PNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGG GDLMAYD

RRGRPGDRYDGM VGFSADETWDSAIDTWSPSEWQMAYEPQ GGSGYD DYSYAGGRGSYGDLGGPIITTQVTIPKD - UNI5752 - LAGSIIGKGG

QRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNS SVKQYSGKFF

For any suggestions or comments, please send an email to unitrap@crg.es